[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF08950.1

[Show Plain Result]


## Summary of Sequence Search
    1::114
    1::87      4e-33  69%   88 aa  PF04362 Iron_traffic "Bacterial Fe(2+) trafficking"
    1::114

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxMARMVHCIKLNKEAEGLDFPPLPGDLGKKIWQNVSKEAWAGWLKHQT
PF04362         -----------------------MARTVFCTKLQKEAEGLDFPPYPGELGKRIYENVSKEAWAEWLEHQT


                         .         .         *         .         .         .         .:140
query           MLINENRLNMADPRARQYLIKQTEKYFFGDGADQAAGYVPxxxx
PF04362         MLINEKRLNMMDPEHRKLLEKEMEKFLFGGGAVKIEGYVP----