[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF09080.1

[Show Plain Result]


## Summary of Sequence Search
    1::264
   28::167     1e-16  43%  169 aa  PF00106 adh_short "short chain dehydrogenase"
    1::264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVTLLGREQAALDATVHALQSCVIEGAALGAVSADITD
PF00106         ---------------------------------VVLTARNAEALEELAAELEAA---GGRVIAVQLDVTD


                         .         .         *         .         .         .         .:140
query           ADWVSGAFAGATEARGPITLLVNNAGQAYSAPFGKTDLALWQRMLEVNLTGTFICTQAALPAMLEAGWGR
PF00106         EASVEALVEEVVEEFGRLDILVNNAGIAGDGPLEDLTEEDFDRVFDVNLLGPFLLTQAALPLMLARGGGR


                         +         .         .         .         .         *         .:210
query           IVNVASTAGLIGYGYVSAYCAAKHGVIGLTRSLALExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00106         IVNISSVAGLLGSPGQAAYAASKAALNGLTRSLAAE----------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00106         ------------------------------------------------------