[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF09298.1

[Show Plain Result]


## Summary of Sequence Search
    1::597
    1::109     5e-36  63%  109 aa  PF06421 LepA_C "GTP-binding protein LepA C-terminus"
    2::180     5e-31  46%  183 aa  PF00009 GTP_EFTU "Elongation factor Tu GTP binding domain"
    2::78      3e-11  37%   88 aa  PF00679 EFG_C "Elongation factor G C-terminus"
    1::597

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxIRNFSIIAHIDHGKSTLADRIIQRCGGLSDREMEAQVLDSMDIEKERGITIKAQTAALSYKARDGQV
PF06421         ----------------------------------------------------------------------
PF00009         ---IRNIGIIGHVDHGKTTLTDRLLYYTGIIDKRGIEAAVLDKLKAERERGITI--DSAAWSFETKK---
PF00679         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAIELGVEVVPVLNKIDLPQADP
PF06421         ----------------------------------------------------------------------
PF00009         YLINIIDTPGHVDFIKEMITGLSQADGAVLVVDAGEGVEPQTREHLLLAFTLGVPLIVVVNKMDRTEEAR
PF00679         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ANAIQEIEDVIGIDAQDATPCSAKTGQGVEDVIEALIAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06421         ----------------------------------------------------------------------
PF00009         FEEIQSLLKKIGYNAVPVVPISALHGDGVLTLLEAIDA--------------------------------
PF00679         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06421         ----------------------------------------------------------------------
PF00009         ----------------------------------------------------------------------
PF00679         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF06421         ----------------------------------------------------------------------
PF00009         ----------------------------------------------------------------------
PF00679         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxILEPIVTVNLYMPQDYVGSVMT
PF06421         ----------------------------------------------------------------------
PF00009         ----------------------------------------------------------------------
PF00679         ------------------------------------------------LLEPIMKVEITVPEEYLGAVMG


                         .         .         +         .         .         .         .:490
query           LCTQKRGAQINMSYHGKQVQLTYEIPMAEIVMDFFDRLKSVSRGYASMDYEFKEYxxxxxxxxxxxINSD
PF06421         ------------------------------------------------------------------INGE
PF00009         ----------------------------------------------------------------------
PF00679         DLSRRRGEILSMEDEGTRVVIKAEVPLRE-MFGYLDELRSLTQGRASFDMEFDGY---------------


                         *         .         .         .         .         +         .:560
query           KVDALSVIVHRSNSQYRGREVAAKMREIIPRQMYDVAIQAAIGSNIIARENVKALRKNVLAKCYGGDISR
PF06421         PVDALSFIVHRDKAYSRGRELVEKLKELIPRQQFEVPIQAAIGGKIIARETIKALRKDVLAKCYGGDISR
PF00009         ----------------------------------------------------------------------
PF00679         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXXXXXRMKQVGTVEIPQEAFLAILQVDxx
PF06421         KRKLLEKQKEGKKRMKQVGNVEIPQEAFLAVLKVD--
PF00009         -------------------------------------
PF00679         -------------------------------------