[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF09387.1

[Show Plain Result]


## Summary of Sequence Search
    1::209
    6::190     1e-07  28%  190 aa  PF01810 LysE "LysE type translocator"
    1::209

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxTPGPNTTIAAVTGANFGLRATLPHCVGVSFGFASIVALCTTGVGA
PF01810         -------------------------TPGPDNALVLSQGLRRGRRAGLATALGIALGDLVLILLAALGLGA


                         .         .         *         .         .         .         .:140
query           LILASPMLATVIHVVGVLYLLWLAYRIARSTSLAEKTVLKPMNVWQSAALQYANIKAWMLALAVAASYMA
PF01810         LLAASPWLFTVLKLAGAAYLLYLGIKALRSAAAAAPPASLRRSFLQGFLVNLLNPKAILFFLALLPQFVD


                         +         .         .         .         .         *         .:210
query           GAPSPGQRVVLVSAIFALFGFFSNGAYGVLGASLRRWLMEGNRVRWFNGAMGLALALTAIWIAVAxxxx
PF01810         PGSGLAQFLLLALGL-VLASLLWFLLLALLASRLRRRLRRPRAWRWINRVSGVLLIGLGVRLAAA----