[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF09441.1

[Show Plain Result]


## Summary of Sequence Search
    1::634
    1::161     1e-36  51%  167 aa  PF00270 DEAD "DEAD/DEAH box helicase"
    5::75      2e-16  52%   76 aa  PF00271 Helicase_C "Helicase conserved C-terminal domain"
    1::634

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxTPVQAQAIPAFLAGRDLLVSSQTGSGKTAAFMLPAIQRISEKPATHRPTEPAKRMKGKRPRPSPAQPS
PF00270         --SPIQAEAIPAILGGRDVLVAAPTGSGKTLAFLLPILQALLETLKNG--------------------PQ
PF00271         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LLVLTPTRELALQVTEAAAKYGRHLRRIVCASILGGMPYPKQLAMLARMPDILVATPGRLLDHIEAGRID
PF00270         ALILAPTRELAEQIYERLKKLLKEPGLRV-GLLVGGVSIEEQLRVLRKGVDIVVGTPGRLLDLLERGKLN
PF00271         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LSALEMLVFDEADRMLDMGFADDIDAIVAATPASRQTLMFSATLxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00270         LSNLRLLVLDEADRLLDQGFGDDLRKILKRLPKKRQTLLFSATL--------------------------
PF00271         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGFSAGALHGDMTQGARN
PF00270         ----------------------------------------------------------------------
PF00271         -----------------------------------------------------GIRVARLHGDLSQEERE


                         .         .         .         .         *         .         .:420
query           RTLTALRRGNLRVLVATDVAARGIDVPDITHVVNFDLPKQAEDYVHRIGRTGRAxxxxxxxxxxxxxxxx
PF00270         ----------------------------------------------------------------------
PF00271         EILERFRRGEVKVLVATDVAERGLDIPDVDLVIDFDLPWSPASYIQRIGRAGRA----------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00270         ----------------------------------------------------------------------
PF00271         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxx
PF00270         ----
PF00271         ----