[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF09446.1

[Show Plain Result]


## Summary of Sequence Search
    1::166
    2::158     6e-47  57%  158 aa  PF00186 DHFR_1 "Dihydrofolate reductase"
    1::166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxLTLIVARARNGVIGRNNTLPWRLPEDLQHFKRTTMGAPIIMGRKTWDSIGRPLPGRRNIVVTRNRDL
PF00186         ---ISLIVAVDENGGIGKDGDLPWHLPEDLKHFKRLTTGNAVIMGRKTWESIPRPLPGRLNIVLSRSLDY


                         .         .         *         .         .         .         .:140
query           HIEGADVVGSIEDAQRLCIGAEQVFLIGGAQLYAEALPSADRLIVTEIDADVEGDAFFPAVDRTTWVETA
PF00186         EAEGVLVVSSLEEALALAKEVEEVFVIGGAQIYKEALPLADRLYLTRIDAEFEGDTFFPEIDPSEW-KLV


                         +         .         .         .         .         *         .:210
query           RELHHSETNGFDYAFVTYExxxxxxx
PF00186         SEEEHDEKNGISYTFVTYK-------