[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF09485.1

[Show Plain Result]


## Summary of Sequence Search
    1::149
    3::143     3e-25  53%  143 aa  PF09424 YqeY "Yqey-like protein"
    1::149

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxRINDDMKXXXXXXXXXXLGTVRLLLAAIKQREVDERIELDDAGITAVIDKMIKQRKDSISQFEQA
PF09424         -----RLKEDLKAAMKAKDKERLSTLRMLLAAIKNAEIDERPELTDEEVLAVLAKMIKQRKESIEEFEKA


                         .         .         *         .         .         .         .:140
query           GRDDLVAKEKAELDVLVAYMPAQLSDAEVAAEVQKAVTESGAAGPQDMGKVMGLVKARLAGRADMTAVSA
PF09424         GREDLAEKERAEIAVLEEYLPQQLSEEELEAAVKEAIAELGASSMKDMGKVMKALKPKLKGRADGKLVSA


                         +         .         .         .         .         *         .:210
query           LVKAALxxx
PF09424         LVKALL---