[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF09694.1

[Show Plain Result]


## Summary of Sequence Search
    1::289
    1::159     1e-28  50%  160 aa  PF03446 NAD_binding_2 "NAD binding domain of 6-phosphogluconate
    1::289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTTVAFIGLGAMGAPMVGHLIRAGHTVRAFVRRPEAADAARQLGAEPFFTPAEAAQGAAVVFTNVTSSED
PF03446         MMKIGFIGLGVMGSPMALNLLKAGHTVTVYDRTPEKVEALVAEGAVAAASPAEAVASADVVITMVPAGAA


                         .         .         *         .         .         .         .:140
query           VREVLLGRNGVVEGAAPGTICVDHSTISPIVTREIAQALAACGIEALDCPVSGGTVGAQAATLTIMVGGK
PF03446         VDAVLFG---LLPGLEKGDIIIDGSTISPADTRRRAAALAAKGIHFLDAPVSGGEEGARAGTLSIMVGGD


                         +         .         .         .         .         *         .:210
query           AEVLEKVRPLLEQIGKTITHIGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03446         EEAFERVKPILEAMGACVTHVG------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF03446         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxx
PF03446         ---------