[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF09846.1

[Show Plain Result]


## Summary of Sequence Search
    1::873
    3::586     1e-59  40%  593 aa  PF00133 tRNA-synt_1 "tRNA synthetases class I (I, L, M and V)"
    7::331     3e-19  36%  363 aa  PF09334 tRNA-synt_1g "tRNA synthetases class I (M)"
    4::131     1e-05  28%  300 aa  PF01406 tRNA-synt_1e "tRNA synthetases class I (C) catalytic
    8::143     1e-05  36%  153 aa  PF08264 Anticodon_1 "Anticodon-binding domain"
   28::59      6e-04  44%  350 aa  PF00750 tRNA-synt_1d "tRNA synthetases class I (R)"
    1::873

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVRNYTINDVMAR
PF00133         --------------QKRWEENGIFEASAR------KGKPKFVIHDGPPYANGSLHIGHALNYTIKDIIAR
PF09334         ----------------------------------------------IPYANGKPHLGHAYTYIAADVLAR
PF01406         --------------------------------PIDPGKVRMYVCGPTVYDYA--HIGHARTYVVFDVLRR
PF08264         ----------------------------------------------------------------------
PF00750         -----------------------------------------------PNPAKPLHVGHLRSAIIGDSLAR


                         .         .         *         .         .         .         .:140
query           YLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYR
PF00133         YKRMQGYNVLYPPGWDCHGLPIEKLGIKGGEKCREWAEEYIGEIREQLKRLGLSVDWDREYFTMDPNYEA
PF09334         YQRLRGYDVLFLTGTDEHGTPIELKAEKEGITPQELVDKYHAEFKELFKKFGISFD--NFIRTTSPEHKE
PF01406         YLRDFGYDVTYVRNITDVDDKIIKRAREEGESIRELAERYIAAFHEDMDALNLPPDVEPRATEHIPEIIE
PF08264         ----------------------------------------------------------------------
PF00750         LLEFAGYDV-------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           WNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLG
PF00133         AVQWVFVKLYEKGLIYRGKRPVNWCPVCGTALAD------------AEVEYKEV----------------
PF09334         LVQEIFLRLYENGDIYKGEYEQWYCPSDETFLPDRQVCPARGDQEGATPVVKEEEHYFFRLSKFQDRLLE
PF01406         FIE----KLIDKGFAYEADGDVYFD---------------------------------------------
PF08264         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DLEGLGWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPL
PF00133         --------------------KSPSVYVKFPL----ADG---DEVYLVVWTTRPETLPGNTAVAV---HPD
PF09334         WYENPDPPSRVNEIINNWL---------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ATHAAESNPALAAFIEECKHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYGDGAVMG
PF00133         IEYVLEKDGEAEALVEKLAKKLLELAD----EKGKDLVGKTYIHPLTGREIPVIAADYVTMDFGTGAVHI
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VPAHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGLGYXXXXXXXXXXXX
PF00133         APAHDEDDYEVGKRHGLPIINVVDEDGRF--TEEAGEFAGLKEKGLLLKIEKYDKLKERALEAVEEVNWV
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXXXEKKVTWRLRDWGISRQRYWGTPIPLIHCDSCGVVPVPEKDLPVVLPEDLVPDGTGNPLAKDPRFL
PF00133         PESGEKRFENWNLRDWCISRQRYWGTPIPVWYCEDGGEVLVGSEELVAARVEEEGADAWLHRPAID----
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ECTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGGIEHAILHLLYARFW
PF00133         --LLPKGGGELRRDTDVLDTWFDSSWPFATLGWP----FEREEFEYFYPADLYVEGSDQ-----IRGWFA
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           TKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQTDERGRPAGATAKADGQPVV
PF00133         SSLMLSTALFG-KAPFKNVLTHGLVL-------------------------DEDGR--------------
PF09334         ------------------------------------------------------GLPLPKKVFAHGFLTV
PF01406         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           IGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFAAPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00133         -----KMSKSLGNVVDPLDVIDKYGADALRLWLASSDP--------------------------------
PF09334         EGG--KMSKSRGNVVDPDDLLDRYGADALRYYLLREGP--------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         ----------------------------------------------------------------------
PF00750         ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxIHTVLKQANYDYERIQYNTVVSATMKMLNALEDAKTASPAGRREGFSVLLR
PF00133         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         -------------------LNETIKKVTEAYENYRFNTALRAIMELLAKDEDSKRRSAQTLYEVLEALLR
PF00750         ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           VLYPVVPHIAHGLWQELGYAAETVDILDAAWPQVDEAALVRSEIELVLQVNGKVRGSLTVPxxxxxxxxx
PF00133         ----------------------------------------------------------------------
PF09334         ----------------------------------------------------------------------
PF01406         ----------------------------------------------------------------------
PF08264         LLAPFLPFTAEEIWQELLGKEESVHL--APWPELDEE--LEAEVELVVQAIRKLRAEKNIP---------
PF00750         ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PF00133         ---------------------------------
PF09334         ---------------------------------
PF01406         ---------------------------------
PF08264         ---------------------------------
PF00750         ---------------------------------