[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:PFM for rmet0:ABF09882.1

[Show Plain Result]


## Summary of Sequence Search
    1::302
   11::238     2e-51  55%  248 aa  PF05621 TniB "Bacterial TniB protein"
    1::302

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWPNKQRMPNLLLVGPT
PF05621         ------------------------------------------------------WPRKQRMPSLLLVGPS


                         .         .         *         .         .         .         .:140
query           NNGKSMIVEKFRRTHPARADADQEHIPVLVVQMPSEPSVIRFYVXXXXXXXXXXXXXXXXXEMEQLALAL
PF05621         GNGKTTIIEKFRRRHPASEDADQERIPVLYVQAPSKPSVKRLYAAILAALGAPLRPRGRLAELEQRALAL


                         +         .         .         .         .         *         .:210
query           LRKVGVRMLVIDELHNVLAGNSVXXXXXXXXXXXXXXXXXIPLVGVGTRDAYLAIRSDDQLENRFEPMML
PF05621         LRECGVRLLIIDEAHHLLAGSSRKQREVLNLLKYLSNELRIPLVLVGTPEALLALRTDPQLARRFEPLEL


                         .         .         .         +         .         .         .:280
query           PVWEANHDCCXXXXXXXXXXPLRRPSSIATLDMARYLLTRSEGTIGELAHLLMAAAIVAVESGEEAINHR
PF05621         PRWEADDDFRSLLASFEAALPLRRPSPLATKDLARYLLARSEGLIGELSRLLRAAAIRAIRSGEEAITHE


                         .         *         .         .         .         .         +:350
query           TLxxxxxxxxxxxxxxxxxxxx
PF05621         TL--------------------