[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF07116.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1lt7A.bssp"
#ERROR : Can't open dsspfile "1hn0A1.bssp"
#ERROR : Can't open dsspfile "1fp4B.bssp"
#ERROR : Can't open dsspfile "1j1jA.bssp"
#ERROR : Can't open dsspfile "1ny5B2.bssp"
#ERROR : Can't open dsspfile "1u6zA3.bssp"
#ERROR : Can't open dsspfile "1ksfX3.bssp"
#ERROR : Can't open dsspfile "1amoA2.bssp"
#ERROR : Can't open dsspfile "2pggA1.bssp"
#ERROR : Can't open dsspfile "1a5tA2.bssp"
#ERROR : Can't open dsspfile "1kq4A.bssp"
#ERROR : Can't open dsspfile "1hqcA2.bssp"
#ERROR : Can't open dsspfile "1sxjE2.bssp"
#ERROR : Can't open dsspfile "1jqjC2.bssp"
#ERROR : Can't open dsspfile "1sxjA2.bssp"
#ERROR : Can't open dsspfile "1um8A.bssp"
#ERROR : Can't open dsspfile "1g8pA.bssp"
#ERROR : Can't open dsspfile "1oz4A2.bssp"
#ERROR : Can't open dsspfile "1ksfX2.bssp"
#ERROR : Can't open dsspfile "1iqpA2.bssp"
#ERROR : Can't open dsspfile "1d2nA.bssp"
#ERROR : Can't open dsspfile "1b00A.bssp"
#ERROR : Can't open dsspfile "1p2fA2.bssp"
#ERROR : Can't open dsspfile "1f51E.bssp"
#ERROR : Can't open dsspfile "1a0oA.bssp"
#ERROR : Can't open dsspfile "1p6qA.bssp"
#ERROR : Can't open dsspfile "1ntcA.bssp"
#ERROR : Can't open dsspfile "1ny5A1.bssp"
#ERROR : Can't open dsspfile "1m5tA.bssp"
#ERROR : Can't open dsspfile "1tmyA.bssp"
#ERROR : Can't open dsspfile "1dcfA.bssp"
#ERROR : Can't open dsspfile "1a04A2.bssp"
#ERROR : Can't open dsspfile "1a2oA1.bssp"
#ERROR : Can't open dsspfile "2gnoA2.bssp"
#ERROR : Can't open dsspfile "1s8nA.bssp"
#ERROR : Can't open dsspfile "1qo0D.bssp"
#ERROR : Can't open dsspfile "1i3cA.bssp"
#ERROR : Can't open dsspfile "1tu1A.bssp"
#ERROR : Can't open dsspfile "1l5yA.bssp"
#ERROR : Can't open dsspfile "1cb7A.bssp"
#ERROR : Can't open dsspfile "1oxbB.bssp"
#ERROR : Can't open dsspfile "1dz3A.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "2nx2A1.bssp"
#ERROR : Can't open dsspfile "2b4aA1.bssp"
#ERROR : Can't open dsspfile "1d5wA.bssp"
#ERROR : Can't open dsspfile "1g2hA.bssp"
#ERROR : Can't open dsspfile "1w25A2.bssp"
#ERROR : Can't open dsspfile "1l8qA2.bssp"
#ERROR : Can't open dsspfile "1gzhB2.bssp"
#ERROR : Can't open dsspfile "1etkA.bssp"
#ERROR : Can't open dsspfile "1xn8A.bssp"
#ERROR : Can't open dsspfile "1heiB1.bssp"
#ERROR : Can't open dsspfile "1bmtA2.bssp"
#ERROR : Can't open dsspfile "1fnnA2.bssp"
#ERROR : Can't open dsspfile "1umqA.bssp"
#ERROR : Can't open dsspfile "1rr7A.bssp"
#ERROR : Can't open dsspfile "1dekA.bssp"
#ERROR : Can't open dsspfile "1do0A.bssp"
#ERROR : Can't open dsspfile "1xrsB1.bssp"
#ERROR : Can't open dsspfile "1cvrA1.bssp"
#ERROR : Can't open dsspfile "2qi2A2.bssp"
#ERROR : Can't open dsspfile "1r8jA2.bssp"
#ERROR : Can't open dsspfile "1ogcA.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "1skoA.bssp"
#ERROR : Can't open dsspfile "1hcrA.bssp"
#ERROR : Can't open dsspfile "1r8wA.bssp"
#ERROR : Can't open dsspfile "1wl8A1.bssp"
#ERROR : Can't open dsspfile "1dv7A.bssp"
#ERROR : Can't open dsspfile "1bknA2.bssp"

## Summary of PDB Search
:444
    1e-47   9%  1lt7A  [c.1.26.1] BETAINE-HOMOCYSTEINE METHYLTRANSFERASE
    2e-47  11%  1hn0A1 [a.102.3.2] CHONDROITIN ABC LYASE I A:235 -- 618
    3e-46   8%  1fp4B  [c.92.2.3] NITROGENASE MOLYBDENUM-IRON PROTEIN BETA CHAIN
    5e-46  11%  1j1jA  [a.118.16.1] TRANSLIN
    1e-41  46%  1ny5B2 [c.37.1.20] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY) B:138 --
    5e-33  15%  1u6zA3 [c.55.1.8] EXOPOLYPHOSPHATASE A:136 -- 312
    3e-32  17%  1ksfX3 [c.37.1.20] ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUNIT
    3e-30  11%  1amoA2 [c.23.5.2] NADPH-CYTOCHROME P450 REDUCTASE A:64 -- 235
    3e-29  10%  2pggA1 [e.8.1.4] RNA-DIRECTED RNA POLYMERASE A:31 -- 804
    1e-28  12%  1a5tA2 [c.37.1.20] DELTA PRIME A:1 -- 207
    3e-27  12%  1kq4A  [d.207.1.1] HYPOTHETICAL PROTEIN TM0449
    1e-24  15%  1hqcA2 [c.37.1.20] RUVB A:5 -- 242
    4e-24  11%  1sxjE2 [c.37.1.20] ACTIVATOR 1 40 KDA SUBUNIT E:4 -- 255
    1e-23  17%  1jqjC2 [c.37.1.20] DNA POLYMERASE III, DELTA SUBUNIT C:1 -- 211
    7e-23  10%  1sxjA2 [c.37.1.20] ACTIVATOR 1 95 KDA SUBUNIT A:295 -- 547
    3e-22  13%  1um8A  [c.37.1.20] ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUNIT
    3e-22  19%  1g8pA  [c.37.1.20] MAGNESIUM-CHELATASE 38 KDA SUBUNIT
    1e-19  14%  1oz4A2 [c.37.1.20] TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE A:201
    1e-17  22%  1ksfX2 [c.37.1.20] ATP-DEPENDENT CLP PROTEASE ATP-BINDING SUBUNIT
    2e-17  18%  1iqpA2 [c.37.1.20] RFCS A:2 -- 232
    4e-17  16%  1d2nA  [c.37.1.20] N-ETHYLMALEIMIDE-SENSITIVE FUSION PROTEIN
    1e-16  30%  1b00A  [c.23.1.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    1e-16  25%  1p2fA2 [c.23.1.1] RESPONSE REGULATOR A:1 -- 120
    4e-16  21%  1f51E  [c.23.1.1] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    7e-16  28%  1a0oA  [c.23.1.1] CHEY
    1e-15  25%  1p6qA  [c.23.1.1] CHEY2
    2e-15  27%  1ntcA  [a.4.1.12] PROTEIN (NITROGEN REGULATION PROTEIN (NTRC))
    6e-15  33%  1ny5A1 [c.23.1.1] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY) A:1 --
    7e-15  24%  1m5tA  [c.23.1.1] CELL DIVISION RESPONSE REGULATOR DIVK
    8e-15  25%  1tmyA  [c.23.1.1] CHEY PROTEIN
    9e-15  21%  1dcfA  [c.23.1.2] ETR1 PROTEIN
    2e-14  19%  1a04A2 [c.23.1.1] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL
    3e-14  28%  1a2oA1 [c.23.1.1] CHEB METHYLESTERASE A:1 -- 140
    4e-14  10%  2gnoA2 [c.37.1.20] DNA POLYMERASE III, GAMMA SUBUNIT-RELATED A:11
    5e-14  16%  1s8nA  [c.23.1.1] PUTATIVE ANTITERMINATOR
    6e-14  13%  1qo0D  [c.23.1.3] AMIR
    6e-14  12%  1i3cA  [c.23.1.1] RESPONSE REGULATOR RCP1
    2e-13  10%  1tu1A  [d.107.1.3] HYPOTHETICAL PROTEIN PA0094
    2e-13  50%  1l5yA  [c.23.1.1] C4-DICARBOXYLATE TRANSPORT TRANSCRIPTIONAL
    3e-13  12%  1cb7A  [c.23.6.1] PROTEIN (GLUTAMATE MUTASE)
    5e-13  19%  1oxbB  [c.23.1.1] SLN1
    9e-13  21%  1dz3A  [c.23.1.1] STAGE 0 SPORULATION PROTEIN A
    2e-12  14%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    2e-12  14%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    3e-12   6%  2nx2A1 [c.129.1.2] HYPOTHETICAL PROTEIN YPSA A:1 -- 177
    4e-12  20%  2b4aA1 [c.23.1.1] BH3024 A:2 -- 119
    1e-11  43%  1d5wA  [c.23.1.1] TRANSCRIPTIONAL REGULATORY PROTEIN FIXJ
    2e-11  24%  1g2hA  [a.4.1.12] TRANSCRIPTIONAL REGULATORY PROTEIN TYRR HOMOLOG
    5e-11  21%  1w25A2 [c.23.1.1] STALKED-CELL DIFFERENTIATION CONTROLLING PROTEIN
    6e-11  17%  1l8qA2 [c.37.1.20] CHROMOSOMAL REPLICATION INITIATOR PROTEIN DNAA
    1e-10  14%  1gzhB2 [c.15.1.4] TUMOR SUPPRESSOR P53-BINDING PROTEIN 1 B:1867 --
    2e-10  25%  1etkA  [a.4.1.12] FACTOR FOR INVERSION STIMULATION
    4e-10  11%  1xn8A  [a.229.1.1] HYPOTHETICAL PROTEIN YQBG
    5e-10  13%  1heiB1 [c.37.1.14] HCV HELICASE B:188 -- 325
    5e-10   5%  1bmtA2 [c.23.6.1] METHIONINE SYNTHASE A:741 -- 896
    5e-10  13%  1fnnA2 [c.37.1.20] CELL DIVISION CONTROL PROTEIN 6 A:1 -- 276
    2e-09  19%  1umqA  [a.4.1.12] PHOTOSYNTHETIC APPARATUS REGULATORY PROTEIN
    3e-09  17%  1rr7A  [a.4.1.14] MIDDLE OPERON REGULATOR
    9e-09  10%  1dekA  [c.37.1.1] DEOXYNUCLEOSIDE MONOPHOSPHATE KINASE
    4e-08  14%  1do0A  [c.37.1.20] PROTEIN (HEAT SHOCK LOCUS U)
    4e-08   8%  1xrsB1 [c.23.6.1] D-LYSINE 5,6-AMINOMUTASE BETA SUBUNIT B:102 --
    6e-08   6%  1cvrA1 [b.1.18.12] GINGIPAIN R A:351 -- 432
    7e-08  23%  2qi2A2 [c.55.4.2] CELL DIVISION PROTEIN PELOTA RELATED PROTEIN
    4e-07  13%  1r8jA2 [c.23.1.5] KAIA A:1 -- 135
    5e-07  13%  1ogcA  [c.133.1.1] HIGH AFFINITY RIBOSE TRANSPORT PROTEIN RBSD
    3e-06  11%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    5e-05  15%  1skoA  [d.110.7.1] MITOGEN-ACTIVATED PROTEIN KINASE KINASE 1
    1e-04  21%  1hcrA  [a.4.1.2] PROTEIN (HIN RECOMBINASE)
    1e-04  18%  1r8wA  [c.7.1.1] GLYCEROL DEHYDRATASE
    2e-04   8%  1wl8A1 [c.23.16.1] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    3e-04  10%  1dv7A  [c.1.2.3] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    8e-04  15%  1bknA2 [d.122.1.2] MUTL A:20 -- 216
:444

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MIAMQDGLRVLFVEDEPLVRQATAQSLELAGFSVLALPSAEAAMPHLGADFPGVLVTDVRLSGASGLDLL
1lt7A           -------------------------------------------------------------------EAV
1hn0A1          ----------------------------------------------------------------------
1fp4B           ----------------------------------------------------------------------
1j1jA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1u6zA3          ----------------------------------------------------------------------
1ksfX3          ----------------------------------------------------------------------
1amoA2          ----------------------------------------------------------------------
2pggA1          ------IAPALVVDSSCLIMNLQ---IKTYGQGSGNAATFINNHLLSTLVLDQWNLMRQPRPDSEEFKSI
1a5tA2          ----------------------------------------------------------------------
1kq4A           ----------------------------------------------------------------------
1hqcA2          ----------------------------------------------------------------------
1sxjE2          ----------------------------------------------------------------------
1jqjC2          ----------------------------------------------------------------------
1sxjA2          ----------------------------------------------------------------------
1um8A           ----------------------------------------------------------------------
1g8pA           ----------------------------------------------------------------------
1oz4A2          ----------------------------------------------------------------------
1ksfX2          ----------------------------------------------------------------------
1iqpA2          ----------------------------------------------------------------------
1d2nA           ----------------------------------------------------------------------
1b00A           ------ARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLDWMLPGGSGIQFI
1p2fA2          --------KIAVVDDDKNILKKVSEKLQQLGRVKTFL-TGEDFLNDEEA--FHVVVLDVXLPDYSGYEIC
1f51E           -------EKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEIL
1a0oA           -------LKFLVVDDFSTMRRIVRNLLKELGFNNVEEEDGVDALNKLQAGGYGFVISDWNMPNMDGLELL
1p6qA           --SLAEKIKVLIVDDQVTSRLLLGDALQQLGFQITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLL
1ntcA           ----------------------------------------------------------------------
1ny5A1          -------MNVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKHFNVVLLDLLLPDVNGLEIL
1m5tA           --------KVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVT
1tmyA           ------GKRVLIVDDAAFMRMMLKDIITKAGYEAGEATNGREAVEKYKELKPDIVTMDITMPEMNGIDAI
1dcfA           MSNFT-GLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVV-SHEHKVVFMDVCMPGVENYQIA
1a04A2          -----EPATILLIDDHPMLRTGVKQLISMAPTVVGEASNGEQGIELAESLDPDLILLDLNMPGMNGLETL
1a2oA1          ------KIRVLSVDDSALMRQIMTEIINSHSDMVATAPDPLVARDLIKKFNPDVLTLDVEMPRMDGLDFL
2gnoA2          ----------------------------------------------------------------------
1s8nA           -------RRVLIAEDEALIRMDLAEMLREEGYEIVGEGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAA
1qo0D           LLGSLRELQVLVLNPPGEVSDALVLQLIRIGCSV-----RQCWPPPEAFDVPVDVVFTSIFQNRHHDEIA
1i3cA           -------KVILLVEDSKADSRLVQEVLKTSTIDHEAXAFLQQQGEYENSPRPNLILLDLNLPKKDGREVL
1tu1A           ---LHEAEIPDAWQDQSINIFKLPASGPAREASFVISRDASQGDAPFAD--YVARQLENAEKQLPGFKLH
1l5yA           --------SVFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPGMDGLALF
1cb7A           -------LGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLELFIKAAIETKADAILVSSLYQGEIDCKGL
1oxbB           -------VKILVVEDNHVNQEVIKRMLNLEGIEIELACDGQEAFDKVKGENYNMIFMDVQMPKVDGLLST
1dz3A           -------IKVCIADDNRELVSLLDEYISSQPEVIGTAYNGQDCLQMLEEKRPDILLLDIIMPHLDGLAVL
1lw7A2          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
2nx2A1          --------VLAITGYKPFELGIF---KQDDKALYYIKKAIKNRLIAFLDEGLEWILISGQLGVEWAAEAA
2b4aA1          -------FRVTLVEDEPSHATLIQYHLNQLGAVTVHPSGSAFFQHRSQLSTCDLLIVSDQLVDLSIFSLL
1d5wA           ------DYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTXLRMPDMSGVELL
1g2hA           ----------------------------------------------------------------------
1w25A2          --ARLDGLRVLIVDDNERQAQRVAAELGVEHRPVIESDPEKAKISAGGPVDLVIVNAAAKNFDGLRFTAA
1l8qA2          ----------------------------------------------------------------------
1gzhB2          ----FQNLKVLLVSDQQQNFLELWSELMTGGAASVKQHHSSAHNKDIALGVFDVVVTDPSCPA--SVLKC
1etkA           ----------------------------------------------------------------------
1xn8A           ---------------------------------------SYSVFESVKTRPDELLKQDILEATADIILKV
1heiB1          ----------------------------------------------------------------------
1bmtA2          -------GKMVIATVKDIGKNIVGVVLQCNNYEIVDLGVMVKILRTAKEVNADLIGLSGLITPSLDEKEM
1fnnA2          ----------------------------------------------------------------------
1umqA           ----------------------------------------------------------------------
1rr7A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1do0A           ----------------------------------------------------------------------
1xrsB1          ------TVGIDAIMNMKGYAGHYGLERYEMAYNLGSQVANEDFIKKAVELEADVLLVSQTVTQKNVHIQN
1cvrA1          -----SAQTFEVACDYNGAIATLSDDGD--MVGTAIVKDGKAII-KLNESIADETNLTLTVVGYNKVTVI
2qi2A2          ----------------------------------------------------------------------
1r8jA2          ---VLSQIAICIWVESTAILQDCQRALSADRYQLQVCESGEMLLEYAHRDQIDCLILVAANPSFRAVVQQ
1ogcA           --------------------------------HGILNSHLAKILADLGHT-DKIVIADAGLPVPDGVLKI
1tueA           ----------------------------------------------------------------------
1skoA           --------------------------------------------------------------SADDLKRL
1hcrA           ----------------------------------------------------------------------
1r8wA           ----------------------------------------------------------------------
1wl8A1          -------MMIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNCEK
1dv7A           -------------------RSRRVDVMDVMNRLILAMMNRDDALRVTGEVREYIDTVKIGYPLVLSAEFR
1bknA2          ---ARFDVTINLSHNGKIVRQYRAVPEGGQKERRLG----------------------------------


                         .         .         *         .         .         .         .:140
query           QHCRNAAPGVPVILVTGHGDITMAVQAMREGAYDFIEKPFGADXXXXXXXXXXXXXXXXXXXXXXXXXXX
1lt7A           RQLHREFLRAGSNVMQTFTVNEAAADIARQVADEGDALVAGGVSQTPSYLSAKSETEVKKVFLQQLEVFM
1hn0A1          ----------------------LPVTPENLAAIDLIRQRLINEFVGGEKETNLALEENISKLKSDFDALN
1fp4B           ----------------------------------------------------------------------
1j1jA           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1u6zA3          ----------------------------------------------------------------------
1ksfX3          ----------------------------------------------------------------------
1amoA2          ----------------------------------------------------------------------
2pggA1          EDKLGINFKIERSIDDIRGKLRQLVLLAQPGYLSGGVEPEQSSPTVELDLLGWSATYSKDLGIYVPVLDK
1a5tA2          ----------------------------------------------------------------------
1kq4A           ----------------------------------------------------------------------
1hqcA2          ----------------------------------------------------------------------
1sxjE2          ----------------------------------------------------------------------
1jqjC2          ----------------------------------------------------------------------
1sxjA2          ----------------------------------------------------------------------
1um8A           --------------------------------LSYIPAPKELKAVLDNYVIGQEQAKKVFSVAVYNHYKR
1g8pA           ----------------------------------------------------------------------
1oz4A2          ----------------------------------------------------------------------
1ksfX2          ----------------------------------------------------------------------
1iqpA2          ----------------------------------------------------------------------
1d2nA           ----------------------------------------------------------------------
1b00A           KHLKRESRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPK---------------------------
1p2fA2          RXIKETRPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPE---------------------------
1f51E           KRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDID---------------------------
1a0oA           KTIRGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAA---------------------------
1p6qA           QAVNPATKKAAFIILTAQGDRALVQKAAALGANNVLAKPFTIE---------------------------
1ntcA           ----------------------------------------------------------------------
1ny5A1          KWIKERSPETEVIVITGHGTIKTAVEAMKMGAYDFLTKPCMLE---------------------------
1m5tA           KWLDDDLAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVV---------------------------
1tmyA           KEIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPS---------------------------
1dcfA           LRIHEKFTRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLD---------------------------
1a04A2          DKLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPE---------------------------
1a2oA1          EKLMRLRPMPVVMVSSLTGKGSETLRALELGAIDFVTKPQLGI---------------------------
2gnoA2          ----------------------------------------------------------------------
1s8nA           SEIASKRI-APIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLS
1qo0D           ALLAAGTPRTTLVALVEYESPAVLSQIIELECHGVITQPLDAHRVLPVLVSARRISEEMAK---------
1i3cA           AEIKQNPDLKRIVVLTTSHNEDDVIASYELHVNCYLTKSRNLK---------------------------
1tu1A           KRWDINIHGHAAVLLREGRDLMLRQVFIERRPAVLITTLT------------------------------
1l5yA           RKILALDPDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAAD---------------------------
1cb7A           RQKCDEAGLEGILLVGKQHWPDVEKRFKDMGYDRVYAPGTPPE---------------------------
1oxbB           KMIRRDLGYSPIVALTAFADDSNIKECLESGMNGFLSKPIKRP---------------------------
1dz3A           ERIRAGFEHPNVIMLTAFGQEDVTKKAVELGASYFILKPFDME---------------------------
1lw7A2          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
2nx2A1          YDLQEEYPDLKVAVITPFYEQEKNWKEPNKEQYEAVLAQA------------------------------
2b4aA1          DIVKEQTKQPSVLILTTGRL-----IESSEHNLSYLQKPFAIS---------------------------
1d5wA           RNLGDLKINIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDT---------------------------
1g2hA           ----------------------------------------------------------------------
1w25A2          LRSEERTRQLPVLAMVDPDDRGRMVKALEIGVNDILSRPIDPQ---------------------------
1l8qA2          ----------------------------------------------------------------------
1gzhB2          AEAL----QLPVVSQEWVIQCLIVGERIGFQHPKYKHDYV------------------------------
1etkA           ----------------------------------------------------------------------
1xn8A           GHDFSDAEYIPLPETVRLALLKLSQFYALINGDESIIKGYTTE---------------------------
1heiB1          ----------------------------------------------------------------------
1bmtA2          ERQGFTIPLLIGGATTSKAHTAVKIEQNYSGPTVYVQNASRTV---------------------------
1fnnA2          ----------------------------------------------------------------------
1umqA           ----------------------------------------------------------------------
1rr7A           ----------------------------------------------------------------------
1dekA           ----------------------------------------------------------------------
1do0A           ----------------------------------------------------------------------
1xrsB1          MTHLEAEGLRDRFVLLCGGPRINNEIAKELGYDAGFGPGRFAD---------------------------
1cvrA1          KDVK------------------------------------------------------------------
2qi2A2          ----------------------------------------------------------------------
1r8jA2          LCFEGV---VVPAIVVGDRD--PAKEQLYHSA--------------------------------------
1ogcA           DLSL--KPGLPAFQDTAAVLAEEMAVEKVIAAAEIKASNQ------------------------------
1tueA           ----------------------------------------------------------------------
1skoA           YKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRP--------------------------------
1hcrA           ----------------------------------------------------------------------
1r8wA           ----------------------------------------------------------------------
1wl8A1          VLEHYDEFNVPILGICLGHQLIAKFFGG------------------------------------------
1dv7A           KRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGF------------------------------
1bknA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GPAAGTRIIGRSPAIAQVRDLIANVAATDVPVMINGETGTGKELVARSLHALSTRRDQPFIALNCGAVPE
1lt7A           KKNVDFLIAEYVEEAVWAVETLIASGKPVAATMAIGPEGDLHGVPPGEAAVRLVKAGASIIGVNCHFDPT
1hn0A1          IHTLANGGITDKQIIIYQPENLNSQDKLFDNYVILGNYTTLMFNISRAYVLEKDPTQKAQLKQMYLLMTK
1fp4B           ------PLFLDQDYKDMLAKKRDGFEKIDEVFQWTTTKEYQELNFQREALTVNPAKACQPLGAVLCALGF
1j1jA           -------VSEIFVELQGFLAAEQ-DIREEIRKVVQSLEQTAREILTL-LQGVHQGAGFQDIPKRCLKARE
1ny5B2          -------YVFESPKMKEILEKIKKISCAECPVLITGESGVGKEVVARLIHKLSDRSKEPFVALNVASIPR
1u6zA3          ---------------------------------------------------------GRKLVIDIGGGS-
1ksfX3          ------LVFGQDKAIEALTEAIKMEHKPVGSFLFAGPTGVGKTEVTV---QLSKALGIELLRFDMSEYME
1amoA2          ----------------KESSFVEKMKKTGRNIIVFYGSQTGTEEFANRLSKDAHRYGMRGMSADPEEYDL
2pggA1          ERLFCSAAYPKGVGIEQAYK-------VVRYEALRLVGGWNYPLLNKACKNNAGARHLEAKGFPLDEFLA
1a5tA2          ------WYPWLRPDFEKLVASYQA-GRGHHALLIQALPGMGDDALIYALSR---YLLCQQPQGHKSCGHC
1kq4A           ----------------------------------------------------------------------
1hqcA2          ------EYIGQERLKQKLRVYLEARKEPLEHLLLFGPPGLGKTTLA---HVIAHELGVNLRVTSGPAIEK
1sxjE2          -------LSHNEELTNFLKSLSDQ-PRDLPHLLLYGPNGTGKKTRCMALLESIFGPGVYRNVVSS-----
1jqjC2          ------------------EQLRAQLNELRAAYLLLGNDPLLLQESQDAVRQVA--AAQGFEEHHTFSIDP
1sxjA2          -------ANWENSKKNSFKHAGKDGSGVFRAAMLYGPPGIGKTTAA---HLVAQELGYDILEQNASDVRS
1um8A           LSFKEKLKKQDNQDSNVELEHLEEVELSKSNILLIGPTGSGKTLMAQTLAKHL---DIPIAISDATSLTV
1g8pA           ------AIVGQEDMKLALLLTAV--DPGIGGVLVFGDRGTGKSTAVRALAALLPEIGCPVSSPNVEMIPD
1oz4A2          -------VGGCRKQLAQIKEMVELPVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLI----NGPEIM
1ksfX2          -------LIGREKELERAIQVLCRRRKNN-PLLV-GESGVGKTAIAEGLAWRIVQGDVPEVMADCTIYSL
1iqpA2          -------IVGQEHIVKRLKHYVK--TGSMPHLLFAGPPGVGKTTAA---LALARELFGENWRHNFLELNA
1d2nA           -------IIKWGDPVTRVLDDGELLVQPLVSVLLEGPPHSGKTALA---AKIAEESNFPFIKICSPDKMI
1b00A           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1ntcA           ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
2gnoA2          ----------------QLETLKRIIEKEGISILINGEDLSYPREVSLELPEYVEKFPPKASDVLE-----
1s8nA           ERLETRKLVERAKGLLQTKHGMTE---PDAFKWIQRAAMDRRTTMKRVAEVVLET---------------
1qo0D           ---------LKQKTEQLQDRIAGQARINQAKVLLMQRHGWDEREAHQHLSREAMKRREPILKI-------
1i3cA           ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1lw7A2          -------------------------------VAILGGESSGKSVLVN---KLAAVFNTTSAWEYGREFVF
1grqA           -------------------------------IILNGGSSAGKSGIVRCLQSVLPEP---WLAFGVDSLIE
2nx2A1          ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1g2hA           ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
1l8qA2          -------IVGEGNAYEVVKEALENLGSLYNPIFIYGSVGTGKTHLLQAAGNEAKKRGYRVIYSSA----D
1gzhB2          ----------------------------------------------------------------------
1etkA           ----------------------------------------------------------------------
1xn8A           ----------------------------------------------------------------------
1heiB1          ---------------------PPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVG-----
1bmtA2          ----------------------------------------------------------------------
1fnnA2          ------RLPHREQQLQQLDILLGNWLRNPGRATLLGRPGTGKTVTLRKLELYKDKTTARFVYINGAIIGE
1umqA           ----------------------------------------------------------------------
1rr7A           ----------------------------------------------------------------------
1dekA           -------------------------------IFLSGVKRSGKDTTADFIMSNYSAVKYQLADALAYAWGV
1do0A           ------HIIGQDNAKRSVAIALRNRWRRMQLILMIGPTGVGKTEIARRLAKLA---NAPFIKVEATKFTE
1xrsB1          ----------------------------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
2qi2A2          -------RSGKYYSEASYFDQIVNALKNYSNSIIILGPGFARDRFARYCAQRGVNVIGSFPANRTGAVYE
1r8jA2          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1tueA           -------QIEFITFLGALKSFLKGTPKKNC-LVFCGPANTGKSYFGM---SFIHFIQGAVISFV------
1skoA           ----------------------------------------------------------------------
1hcrA           ----------------------------------------------------------------------
1r8wA           -------LLKNAPKFGNDIDEVDNLAREGALVYCREVNKYTNPRGGNFQPGLYPSSINVYFGSLTGATPD
1wl8A1          ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           SIFESEMFGHEAGAFTGAGKRRVGKLEHASGGTLFLDEIESMPLALQVKLLRVLQEGTLERLGSNTSIPI
1lt7A           ISLKTVMKEGLEAAQLKAHLSQPLAYHTPDANKQGFIDLPEFPFGLEPRVATRWDIQKYAREAYNLGVRY
1hn0A1          HLLDQGFVK---GSALVTTHHWGSSRWWYISTLLMSDALKEANLQTQVSLLWYSREFKSSFDMKVSADSS
1fp4B           EKTMPYVHGSQGCVAYFRSYFNRHFREPVSCVSDSMTEDA-AVFGGQQNMKDGLQNCK-ATYKPDMIAVS
1j1jA           HFLKTKFPAEQYYRFHEHWRFVLQRVYLETETLVTREAVTEILGIEREKGFHLDVEDYLSGVLILASELS
1ny5B2          DIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEIGELSLEAQAKLLRVIESGKFYRLGGRKEIEV
1u6zA3          ----TELVIGENFEPILVESRRMGAQLYFPGGVINKENFQRARMAAAQKLETLTWQFRIQGW---NVAMG
1ksfX3          RHTVSRLIGAPPGYVGFDQGGLLDAVIKHPHAVLLLDEIEKAHPDVFNILLQVMDNGTLTDNNGRKADFR
1amoA2          ADLSSLPEIDKSLVVFCMATYGEG--DPTDNAQDFYDWLQETDVDLTGVKFAVFGLGNKTYEHFNAMGKY
2pggA1          EWSELSEFGE---AFEGFNIKLTVTSELAELNKPVPPKPPNVNRPVNTGGLKAVSNALKTGRYRNEAGLS
1a5tA2          RGCQLMQAGTHPDYYTLAPEKGKNTLG-VDAVREVTEKLNEHARLGGAKVVWVTDAALLTDAAANALLKT
1kq4A           ------------------------ELVDVXGNDLSAVRAARVSFERDRHLIEYLXKHGHETPFEHIVFTF
1hqcA2          PGDLAAILANSLEEGD----------------ILFIDEIHRLSRQAEEHLYPAMEDFVMDIVIGQGPAAR
1sxjE2          --PYHLEITPSNDRIVIQELLKEVAQMEQRYKCVIINEANSLTKDAQAALRRTMEKYSKNIRLIMVCDSM
1jqjC2          NTDWNAIFSLCQAMS-----------LFASRQTLLLLLPENGPNAAINEQLLTL-----------TGLLH
1sxjA2          KTLLNAGVKNALDNMSVVG-YFKHQNLNGKHFVIIMDEVDGMSGGDRGGVGQLAQFCRKTS---------
1um8A           ENILTRLLQASDWNV-----------QKAQKGIVFIDEIDKIGEGVQQALLKIVEGSLVNQIDTSDILFT
1g8pA           WATVLSTNVIRKPTPVVDLPLGVGLLARANRGYLYIDECNLLEDHIVDLLLDVAQSGENERDGLSIRHPA
1oz4A2          SKLAGESESNLRKAFEEAEKNAPA--------IIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQ
1ksfX2          DIGAGTKY---RGDFEKRFKALLKQLEQDTNSILFIDEIHTIIGAGAASGGQVDAANLIKPLLSSG----
1iqpA2          SDERGINVIREKVKEFA----RTKPIGGASFKIIFLDEADALTQDAQQALRRTMEMF-----------SS
1d2nA           GFSETAKCQAMKKIFDDAYKSQLSCV--------VVDDIERLLDYVPIGPRFSNLQALLVLLKKAPPQGR
1b00A           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1ntcA           ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
2gnoA2          --IDPEGENIGIDDIRTIKDFLNYSPELYTRKYVIVHDCERXTQQAANAFLKALEEPPEYAVIVLNTRRW
1s8nA           ----------------------------------------------------------------------
1qo0D           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1lw7A2          EKLGGDEQAMQYSDYPQXALGHQRYIDYASHKIAFIDTDFITTQAFCIQYEGKAHPFLDSXIKEY---PF
1grqA           AMPLKMQSAEGGIEFDADGGVSIGPEFRALEGAWIIDDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAV
2nx2A1          ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1g2hA           ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
1l8qA2          DFAQAXVEHLKKGTINEF------RNXYKSVDLLLLDDFLSGKERTQIEFFHIFNTLYLLE---------
1gzhB2          ----------------------------------------------------------------------
1etkA           ----------------------------------------------------------------------
1xn8A           ----------------------------------------------------------------------
1heiB1          ---------SPITYSTYGKFLADGGCSGGAYDIIICDECHSTDATSILGIGTVLDQAETAG---------
1bmtA2          ----------------------------------------------------------------------
1fnnA2          IARSLNIPFPRRGLSRDEFLALLVEHLRERDLYMVLDDAFNLAPDILSTFIRLGQEADKLGAFRIALVIV
1umqA           ----------------------------------------------------------------------
1rr7A           ----------------------------------------------------------------------
1dekA           FAANTDYPXLTRKEFEGIDYDRETNLNLTKLEVITIMEQAFCYLNGKSPIKGVFVFDDEGKESVNFVAKI
1do0A           VGYVGKEVDSIIR-----------DLTDAAVKMVRVQAIEKNRYRAEELAEERILDVLIPPAKNNWGQTE
1xrsB1          ----------------------------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
2qi2A2          FITSADGA--------------------------------------------------------------
1r8jA2          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1tueA           -------NSTSHFWLEPLTDTKV----------AMLDDATTTCWTYFDTYMRNALDGNPISIDPLIQLK-
1skoA           ----------------------------------------------------------------------
1hcrA           ----------------------------------------------------------------------
1r8wA           GRKSGQPLADGVSPSRGCDVNSVSKLDHFIASNGTLFNQKFHPSALGLMNLSSLIRSYFDQKGFHVQFNV
1wl8A1          ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DVRIIAASKGDMEALVAQGTFRQDLLYRLNVVTIPLPPLRERREDIVPLFEHFMLVAAVRYQRPAPILSE
1lt7A           IGGCCGFEPYHIRA------IAEELAPERGFLPPRARARKEYWENLRIASGRPY---NPSMSKP------
1hn0A1          DLDY----------------FNTLSRQHLALLLLE-PDDQKRINLVNTFSHYITGALTQVPPGGKDGLRP
1fp4B           TTCMAEVIGDDLNAFINNSKKEGFIPDEFPVPFAHTPSFVGSHVTGWDNMFEGIARYFTLKSMDDKVSNK
1j1jA           RLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYD--------------------------
1ny5B2          NVRILAATNRNIKELVKEGKFREDLYYRLGVIEIEIPPLRERKEDIIPLANHFLKKFSRKYAKEVEGFTK
1u6zA3          ASGTIKAAHEVLMEMGEKDGIVKEVLRHRNFASLSLPGLSEERKTVFVPGLAILCGVFDALAIRELRLSD
1ksfX3          NVVLVMTTNAGVRNEEIKKIFTPEFRNRLDNIIWFDHLSTDVIHQVVDKFIVE-LQVQLDQKGVSLEVSQ
1amoA2          VDQRLEQLGAQR----------------------------------------------------------
2pggA1          GLVLLATARSRLQDAVKAKAEAEKLHKSKPD--DPDADWFERSETLSDLLEKADIA--------------
1a5tA2          LEEPPAETWFFLAT-REPERLLATLRSRCRLHYLAPPPEQYAVTWLSREVTMSALLAALRLSAGSP----
1kq4A           HVKAPIFVHRIASYNELSSYE----FYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLEIESGVPR
1hqcA2          TIRLELPRFTLIGATTRPGLITAPLLSRFGIVEHLEYYTPEELAQGVMRDARLL----------GVRITE
1sxjE2          SPIIAP------------------IKSQCLLIRCPAPSDSEISTILSDVVTNERI-----------QLET
1jqjC2          DDLLLIVRGNKLSKAQENAAWFTALANRSVQVTCQTPEQAQLPRWVAARAKQL------------NLELD
1sxjA2          TPLILICNERNLP-------KMRPFDRVCLDIQFRRPDANSIKSRLMTIAIREKFKLDPNVIDRLIQTTR
1um8A           TQNVLGFTQEKMSKKEQEAILHLELIGRLPVLSTLDSISLEAMVDILQKPKNALIKQYQQLFKMDEVFEE
1g8pA           RFVLVGSGNPEEGDLRPQLLDRFGLSVEV-------LSPRDVETRVEVIRRRDTYDADPKAFLEEWRPKD
1oz4A2          RAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEIQIHTKNMKLADDVDLEQVANETHGHVG
1ksfX2          KIRVIGSTTYQEFSNIFE--KDRALARRFQKIDITEPSIEETVQIINGLKPKYEAHHDVRY---------
1iqpA2          NVRFILSCNYS-------SKIIEPIQSRCAIFRFRPLRDEDIAKRLRYIAENEGL-----------ELTE
1d2nA           KLLIIGTTKDVLQEMEMLNAFS---------TTIHVPNIATGEQELLGNFKDKERTTIAQQVKGKKVWIG
1b00A           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1ntcA           ----------------------------------------------------------------------
1ny5A1          ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
2gnoA2          H------------------YLLPTIKSRVFRVVVNVPKEFRDLVKE-KIGDLWEELPLLERDFK---TAL
1s8nA           ----------------------------------------------------------------------
1qo0D           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1lw7A2          DVTILLKNNTEQKQRQQFQQLLKKLLYKVPYIEIESPSYLDRYNQVKAVIEKVLN---------------
1grqA           AEGRETARGDRVAGMAAKYVVHEGVEYDVEVDTTHKESIECAWAIA------------------------
2nx2A1          ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1g2hA           ----------------------------------------------------------------------
1w25A2          ----------------------------------------------------------------------
1l8qA2          KQIILASDRHPQKLDGVSDRLVSRFEGGI---LVEIELDNKTRFKII----------KEKLKEFNLELRK
1gzhB2          ----------------------------------------------------------------------
1etkA           ----------------------------------------------------------------------
1xn8A           ----------------------------------------------------------------------
1heiB1          ARLVVLAT--------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1fnnA2          GHNDAVL----NNLDPSTRGIMGKYVIRFS------PYTKDQIFDILLDRAKAGLAEGSYSEDILQMIAD
1umqA           ----------------------------------------------------------------------
1rr7A           ----------------------------------------------------------------------
1dekA           TDVINNIEDQWSVRRLMQALGTDLIVNNFDRMYWVKLFALDYLDKFNSGYDYYIVPDTHEMDAARATVIH
1do0A           QQQEPSAARQAFRKKLREGQLDDKLKIKDAMKLLIEEEAAKLVNPEELKQDAIDAVEQHGIVFIDEIDKI
1xrsB1          ----------------------------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
2qi2A2          ----------------------------------------------------------------------
1r8jA2          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1tueA           CPPILLTTNIHPAKDNRWPYLES----RITVFEFPNAPFDKNGNPVYEIND-------------------
1skoA           ----------------------------------------------------------------------
1hcrA           ----------------------------------------------------------------------
1r8wA           ------IDKKILLAAQKNPEKYQDLIVRVAGYSAQFISLKSIQNDIIARTEH------------------
1wl8A1          ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           MQRQQLMQRPWPGNVRELRNAADRLVLGVPEGGHAGGKADPVDESTPLRERMERYERAVIADTLARTGGA
1lt7A           ----------------------------------------------------------------------
1hn0A1          DGTAWRHEGNYPGYSFPAFKNASQLIYAWIYSNPEVGLPLAGRHPFNSPSLKSVAQGYYWLAMSAKSSPD
1fp4B           KINIVPGFETYLGNFRVIKRMLSEMGVGYSLLSDPEEVLDTPADGGTTQEEMKDAPNALNTVLLQPWHLE
1j1jA           ----------------------------------------------------------------------
1ny5B2          SAQELLLSYPWYGNVRELKNVIERAVL-------------------------------------------
1u6zA3          GALREGVLYEMEGRFR------------------------------------------------------
1ksfX3          EARNWLAEKDRAMGARPMARVIQDNLK-------------------------------------------
1amoA2          ----------------------------------------------------------------------
2pggA1          ----------------------------------------------------------------------
1a5tA2          ----------------------------------------------------------------------
1kq4A           EVARIVLRFFWTVNARSLXNFLNL----------------------------------------------
1hqcA2          EAALEIGRR-SRGTMRVAKRLFRRVRD-------------------------------------------
1sxjE2          KDILKRIAQASNGNLRVSLLMLESMAL-------------------------------------------
1jqjC2          DAANQVLCYCYEGNLLALAQALERLSL-------------------------------------------
1sxjA2          GDIRQVIKTINHENINEISKAWEKNI--------------------------------------------
1um8A           EAIKEIAQLALERKARGLRAIIEDFCLDIMFDLPKLKGSEVRITKDCVLKQAEPL---------------
1g8pA           IRNQILEARERLPKVEAPNTALYDCAALCIALG-------------------------------------
1oz4A2          ADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDD----FRWALSQSNPSALRETV------
1ksfX2          ----------------------------------------------------------------------
1iqpA2          -EGLQAILYIAEGDMRRAINILQAAAA-------------------------------------------
1d2nA           IKKEMSLQMDPEYRVRKFLALLREEG--------------------------------------------
1b00A           ----------------------------------------------------------------------
1p2fA2          ----------------------------------------------------------------------
1f51E           ----------------------------------------------------------------------
1a0oA           ----------------------------------------------------------------------
1p6qA           ----------------------------------------------------------------------
1ntcA           ---------DLPGELFEASTPDSPSHLPPDSWAQWADRALRSGHQNLLSEAQPELERTLLTTALRHTQGH
1ny5A1          ----------------------------------------------------------------------
1m5tA           ----------------------------------------------------------------------
1tmyA           ----------------------------------------------------------------------
1dcfA           ----------------------------------------------------------------------
1a04A2          ----------------------------------------------------------------------
1a2oA1          ----------------------------------------------------------------------
2gnoA2          EAYKLGAEK-------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1qo0D           ----------------------------------------------------------------------
1i3cA           ----------------------------------------------------------------------
1tu1A           ----------------------------------------------------------------------
1l5yA           ----------------------------------------------------------------------
1cb7A           ----------------------------------------------------------------------
1oxbB           ----------------------------------------------------------------------
1dz3A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1grqA           ----------------------------------------------------------------------
2nx2A1          ----------------------------------------------------------------------
2b4aA1          ----------------------------------------------------------------------
1d5wA           ----------------------------------------------------------------------
1g2hA           ----------------------------------SAVISLDEFENKTLDEIIGFYEAQVLKLFYAEYPS-
1w25A2          ----------------------------------------------------------------------
1l8qA2          EVIDYLLEN--TKNVREI----------------------------------------------------
1gzhB2          ----------------------------------------------------------------------
1etkA           ----------------------------------------------LYELVLAEVEQPLLDMVMAYTRGN
1xn8A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
1bmtA2          ----------------------------------------------------------------------
1fnnA2          ITGAQTPLDTNRGDARLAIDI-------------------------------------------------
1umqA           ------------------------------------------ESLPPPPENADRVRWEHIQRIYEMCDRN
1rr7A           ----------FPALLAELNDLLRGELSRLGVDPVAICKHLGGGQVYIPRGQALDSLIRDLRIWNDFNGRN
1dekA           VVRPGQKSNDTHITEAGLPIRDGDLVI-------------------------------------------
1do0A           CKRGESSGPDVSREGVQ-----------------------------------------------------
1xrsB1          ----------------------------------------------------------------------
1cvrA1          ----------------------------------------------------------------------
2qi2A2          ----------------------------------------------------------------------
1r8jA2          ----------------------------------------------------------------------
1ogcA           ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
1skoA           ----------------------------------------------------------------------
1hcrA           -------------------------------------------------------HEQEQISRLLEKGHP
1r8wA           ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1dv7A           ----------------------------------------------------------------------
1bknA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VSQAADLLQVGKATLYDKIKRYGL
1lt7A           ------------------------
1hn0A1          KTLASIYLAISDKTQNESIFGETI
1fp4B           KTKKFVEGTWKHEV----------
1j1jA           ------------------------
1ny5B2          ------------------------
1u6zA3          ------------------------
1ksfX3          ------------------------
1amoA2          ------------------------
2pggA1          ------------------------
1a5tA2          ------------------------
1kq4A           ------------------------
1hqcA2          ------------------------
1sxjE2          ------------------------
1jqjC2          ------------------------
1sxjA2          ------------------------
1um8A           ------------------------
1g8pA           ------------------------
1oz4A2          ------------------------
1ksfX2          ------------------------
1iqpA2          ------------------------
1d2nA           ------------------------
1b00A           ------------------------
1p2fA2          ------------------------
1f51E           ------------------------
1a0oA           ------------------------
1p6qA           ------------------------
1ntcA           KQEAARLLGWGAATLTAKLKELGM
1ny5A1          ------------------------
1m5tA           ------------------------
1tmyA           ------------------------
1dcfA           ------------------------
1a04A2          ------------------------
1a2oA1          ------------------------
2gnoA2          ------------------------
1s8nA           ------------------------
1qo0D           ------------------------
1i3cA           ------------------------
1tu1A           ------------------------
1l5yA           ------------------------
1cb7A           ------------------------
1oxbB           ------------------------
1dz3A           ------------------------
1lw7A2          ------------------------
1grqA           ------------------------
2nx2A1          ------------------------
2b4aA1          ------------------------
1d5wA           ------------------------
1g2hA           TRKLAQRLGVSHTAIANKLKQYGI
1w25A2          ------------------------
1l8qA2          ------------------------
1gzhB2          ------------------------
1etkA           QTRAALMMGINRGTLRKKLKKYGM
1xn8A           ------------------------
1heiB1          ------------------------
1bmtA2          ------------------------
1fnnA2          ------------------------
1umqA           VSETARRLNMHRRTLQRILAKRSP
1rr7A           VSELTTRYGVTFNTVYKAIRRMRR
1dekA           ------------------------
1do0A           ------------------------
1xrsB1          ------------------------
1cvrA1          ------------------------
2qi2A2          ------------------------
1r8jA2          ------------------------
1ogcA           ------------------------
1tueA           ------------------------
1skoA           ------------------------
1hcrA           RQQLAIIFGIGVSTLYRYFPASSI
1r8wA           ------------------------
1wl8A1          ------------------------
1dv7A           ------------------------
1bknA2          ------------------------