[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF07164.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1m5tA.bssp"
#ERROR : Can't open dsspfile "1s8nA.bssp"
#ERROR : Can't open dsspfile "1a0oA.bssp"
#ERROR : Can't open dsspfile "1p6qA.bssp"
#ERROR : Can't open dsspfile "1tmyA.bssp"
#ERROR : Can't open dsspfile "1w25A2.bssp"
#ERROR : Can't open dsspfile "1b00A.bssp"
#ERROR : Can't open dsspfile "1bmtA2.bssp"
#ERROR : Can't open dsspfile "1a04A2.bssp"
#ERROR : Can't open dsspfile "1i3cA.bssp"
#ERROR : Can't open dsspfile "1f51E.bssp"
#ERROR : Can't open dsspfile "1tu1A.bssp"
#ERROR : Can't open dsspfile "1oxbB.bssp"

## Summary of PDB Search
:219
    6e-07  18%  1m5tA  [c.23.1.1] CELL DIVISION RESPONSE REGULATOR DIVK
    7e-07  25%  1s8nA  [c.23.1.1] PUTATIVE ANTITERMINATOR
    1e-06  19%  1a0oA  [c.23.1.1] CHEY
    3e-06  14%  1p6qA  [c.23.1.1] CHEY2
    4e-06  17%  1tmyA  [c.23.1.1] CHEY PROTEIN
    7e-06  18%  1w25A2 [c.23.1.1] STALKED-CELL DIFFERENTIATION CONTROLLING PROTEIN
    7e-06  21%  1b00A  [c.23.1.1] PHOSPHATE REGULON TRANSCRIPTIONAL REGULATORY
    2e-05  13%  1bmtA2 [c.23.6.1] METHIONINE SYNTHASE A:741 -- 896
    2e-05  16%  1a04A2 [c.23.1.1] NITRATE/NITRITE RESPONSE REGULATOR PROTEIN NARL
    6e-05  14%  1i3cA  [c.23.1.1] RESPONSE REGULATOR RCP1
    1e-04  16%  1f51E  [c.23.1.1] SPORULATION INITIATION PHOSPHOTRANSFERASE F
    2e-04   9%  1tu1A  [d.107.1.3] HYPOTHETICAL PROTEIN PA0094
    4e-04  21%  1oxbB  [c.23.1.1] SLN1
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxLRILLVRDPHEADPLNVETIRAGLAQAGFTEVQTVDADLRLP
1m5tA           -----------------------------KVLIVED----NELNMKLFHDLLEAQGY-ETLQTREGLSAL
1s8nA           ----------------------------RRVLIAED----EALIRMDLAEMLREEGYEIVGEAGDGQEAV
1a0oA           ----------------------------LKFLVVDD----FSTMRRIVRNLLKELGFNNVEEAEDGVDAL
1p6qA           ----------------------------IKVLIVDD----QVTSRLLLGDALQQLGFKQITAAGDGEQGM
1tmyA           ----------------------------KRVLIVDD----AAFMRMMLKDIITKAGYEVAGEATNGREAV
1w25A2          -----------------------------RVLIVDD----NERQAQRVAAELGVEHRPVIESDPEKAKI-
1b00A           ----------------------------RRILVVED----EAPIREMVCFVLEQNGFQPVEAEDYDSAV-
1bmtA2          ----------------------------GKMVIATVKGDVHDIGKNIVGVVLQCNNYEIVDLGVMVEKIL
1a04A2          ----------------------------ATILLIDD----HPMLRTGVKQLISMAPITVVGEASNGEQGI
1i3cA           ----------------------------KVILLVED----SKADSRLVQEVLKTSTIDGLAAXAFLQQQG
1f51E           ----------------------------EKILIVDD----QSGIRILLNEVFNKEGY-QTFQAANGLQAL
1tu1A           -----------------------------DLEIP-DAWQDQSINIFKLPASGPAREASFVISRDASQGDA
1oxbB           ----------------------------VKILVVED----NHVNQEVIKRMLNLEGIENIELACFDKVKE


                         .         .         *         .         .         .         .:140
query           DTITASQPDLVIIASESAARDTIEHVCVSTQHAPRPIVLFTDNDDAQRIKAALSAGITAYIVDGLRAERV
1m5tA           SIARENKPDLILMDIQLPEISGLEVTKWLKEDDDLPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHF
1s8nA           ELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLV--------
1a0oA           NKLQAGGYGFVISMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL
1p6qA           KIMAQNPHHLVISDFNMPKMDGLGLLQAVRANPAAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKM
1tmyA           EKYKELKPDIVTMDITMPEMNGIDAIKIMKIDPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRV
1w25A2          --SAGGPVDLVIVNAAAKNFDGLRFTAALRSEERTRVLAMVDPDDRGRMVKALEIGVNDILSRPIDPQEL
1b00A           NQLNEPWPDLILLDWMLPGGSGIQFIKHLKRERDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKEL
1bmtA2          RTAKEVNADLIGLGLITPSLDEMVNVAKEMERQGFTIGATTSKAHTAVKIEQNYSGPTVYVQNASRTVGV
1a04A2          ELAESLDPDLILLDLNMPGMNGLETLDKLREKSLSGRIVVSVSNHEEDVVTALKRGADGYLLKDMEPEDL
1i3cA           EYENSPRPNLILLDLNLPKKDGREVLAEIKQNPDIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDL
1f51E           DIVTKERPDLVLLDMKIPGMDGIELKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEI
1tu1A           ---PFADYVARQLENAEKQLPGFKLHRWDINIHGHAAVLQREGRDLMLRQVFIERRPAVLITTLTTTPHH
1oxbB           LTSKGENYNMIFMDVQMPKVDGLLKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKL


                         +         .         .         .         .         *         .:210
query           KTVLDVAYARFQLDQQLRAELDATKLKLAERxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1m5tA           LETIKRLLER------------------------------------------------------------
1s8nA           ----------------------------------------------------------------------
1a0oA           EEKLNKIFEKLGM---------------------------------------------------------
1p6qA           KAAIEAVFGALK----------------------------------------------------------
1tmyA           VEAL------------------------------------------------------------------
1w25A2          SARVKTQIQRKRYTDYLRNNLDSLELAVTDQ---------------------------------------
1b00A           VARIKAVMRR------------------------------------------------------------
1bmtA2          VAALLSDTQRDDFVARTRKEYETVRIQHG-----------------------------------------
1a04A2          LKALHQAAAGEMVLSEALTPVLAASL--------------------------------------------
1i3cA           FKXVQGIESFWLETVTLPA---------------------------------------------------
1f51E           RDAV------------------------------------------------------------------
1tu1A           EPAWKQAMQTLVP---------------------------------------------------------
1oxbB           KTIL------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxx
1m5tA           ---------
1s8nA           ---------
1a0oA           ---------
1p6qA           ---------
1tmyA           ---------
1w25A2          ---------
1b00A           ---------
1bmtA2          ---------
1a04A2          ---------
1i3cA           ---------
1f51E           ---------
1tu1A           ---------
1oxbB           ---------