[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF07169.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1hr6A2.bssp"
#ERROR : Can't open dsspfile "1hr6B2.bssp"
#ERROR : Can't open dsspfile "2fgeA2.bssp"
#ERROR : Can't open dsspfile "1bccB2.bssp"
#ERROR : Can't open dsspfile "2fgeA3.bssp"
#ERROR : Can't open dsspfile "1bccA1.bssp"
#ERROR : Can't open dsspfile "1ezvA2.bssp"
#ERROR : Can't open dsspfile "1hr6A1.bssp"
#ERROR : Can't open dsspfile "1bccB1.bssp"
#ERROR : Can't open dsspfile "2fgeA4.bssp"
#ERROR : Can't open dsspfile "1ezvB1.bssp"
#ERROR : Can't open dsspfile "1q2lA1.bssp"
#ERROR : Can't open dsspfile "1q2lA4.bssp"
#ERROR : Can't open dsspfile "2fgeA1.bssp"
#ERROR : Can't open dsspfile "1ezvA1.bssp"
#ERROR : Can't open dsspfile "1bccA2.bssp"
#ERROR : Can't open dsspfile "1hr6A2.bssp"
#ERROR : Can't open dsspfile "1hr6B2.bssp"
#ERROR : Can't open dsspfile "1bccA1.bssp"
#ERROR : Can't open dsspfile "1ezvA2.bssp"
#ERROR : Can't open dsspfile "1hr6A1.bssp"
#ERROR : Can't open dsspfile "1bccB1.bssp"
#ERROR : Can't open dsspfile "2fgeA4.bssp"
#ERROR : Can't open dsspfile "1ezvB1.bssp"
#ERROR : Can't open dsspfile "1q2lA1.bssp"
#ERROR : Can't open dsspfile "1q2lA4.bssp"
#ERROR : Can't open dsspfile "1ezvA1.bssp"

## Summary of PDB Search
:454
    5e-36  14%  1hr6A2 [d.185.1.1] MITOCHONDRIAL PROCESSING PEPTIDASE ALPHA SUBUNIT
    3e-31  15%  1hr6B2 [d.185.1.1] MITOCHONDRIAL PROCESSING PEPTIDASE BETA SUBUNIT
    1e-30  14%  2fgeA2 [d.185.1.1] ZINC METALLOPROTEASE (INSULINASE FAMILY) A:798
    3e-30  16%  1bccB2 [d.185.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE B:236 --
    1e-29  12%  2fgeA3 [d.185.1.1] ZINC METALLOPROTEASE (INSULINASE FAMILY) A:272
    2e-25  17%  1bccA1 [d.185.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE A:4 -- 232
    1e-24  17%  1ezvA2 [d.185.1.1] UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE
    2e-23  14%  1hr6A1 [d.185.1.1] MITOCHONDRIAL PROCESSING PEPTIDASE ALPHA SUBUNIT
    1e-22  15%  1bccB1 [d.185.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE B:18 --
    3e-21  14%  2fgeA4 [d.185.1.1] ZINC METALLOPROTEASE (INSULINASE FAMILY) A:15 --
    3e-19  11%  1ezvB1 [d.185.1.1] UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE
    1e-18  11%  1q2lA1 [d.185.1.1] PROTEASE III A:504 -- 732
    9e-18  13%  1q2lA4 [d.185.1.1] PROTEASE III A:24 -- 263
    4e-15  11%  2fgeA1 [d.185.1.1] ZINC METALLOPROTEASE (INSULINASE FAMILY) A:540
    6e-15  21%  1ezvA1 [d.185.1.1] UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE
    7e-14  15%  1bccA2 [d.185.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE A:233 --
    2e-06  11%  1hr6A2 [d.185.1.1] MITOCHONDRIAL PROCESSING PEPTIDASE ALPHA SUBUNIT(query 140->247)
    2e-12  20%  1hr6B2 [d.185.1.1] MITOCHONDRIAL PROCESSING PEPTIDASE BETA SUBUNIT(query 141->246)
    3e-04  17%  1bccA1 [d.185.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE A:4 -- 232(query 343->450)
    3e-13  13%  1ezvA2 [d.185.1.1] UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE(query 141->246)
    7e-05  13%  1hr6A1 [d.185.1.1] MITOCHONDRIAL PROCESSING PEPTIDASE ALPHA SUBUNIT(query 274->450)
    1e-05  16%  1bccB1 [d.185.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE B:18 --(query 343->450)
    2e-04  19%  2fgeA4 [d.185.1.1] ZINC METALLOPROTEASE (INSULINASE FAMILY) A:15 --(query 419->450)
    2e-04   7%  1ezvB1 [d.185.1.1] UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE(query 343->450)
    2e-06  12%  1q2lA1 [d.185.1.1] PROTEASE III A:504 -- 732(query 322->450)
    0.001  14%  1q2lA4 [d.185.1.1] PROTEASE III A:24 -- 263(query 416->450)
    9e-05  12%  1ezvA1 [d.185.1.1] UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE(query 351->451)
:454

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPIESWTASTGAKVFFVPSPSIPMLDVNIDFDAG
1hr6A2          ----------------------------------------------------------------------
1hr6B2          ----------------------------------------------------------------------
2fgeA2          ----------------------------------------------------------------------
1bccB2          ----------------------------------------------------------------------
2fgeA3          ----------------------------------------------------------------------
1bccA1          -------------------------------------ETQVSQLDNGVRVA-SEQSSQPTCTVGVWIDAG
1ezvA2          ----------------------------------------------------------------------
1hr6A1          --------------------------------------FKLSSLANGLKVATSNTPG-HFSALGLYIDAG
1bccB1          -------------------------------------DLEITKLPNGLVIASLENYS-PGSTIGVFIKAG
2fgeA4          --------------------------------------------KTGCEVXSVSNEDENKV-----FGVV
1ezvB1          -------------------------------------------------TVSARDAPTKISTLAVKVHGG
1q2lA1          ----------------------------------------------NLRVVYAPSRYFASEDVSLILRNP
1q2lA4          ----------------------------------------------GMVVLLVSDPQAVKSLSALVVPVG
2fgeA1          -------------------------------------VPTEVGDINGVKVLRHDLFTNDIIYTEVVFDIG
1ezvA1          ----------------------------------------------------------------------
1bccA2          ----------------------------------------------------------------------
1hr6A2          ----------------------------------------------------------------------
1hr6B2          ----------------------------------------------------------------------
1bccA1          ----------------------------------------------------------------------
1ezvA2          ----------------------------------------------------------------------
1hr6A1          ----------------------------------------------------------------------
1bccB1          ----------------------------------------------------------------------
2fgeA4          ----------------------------------------------------------------------
1ezvB1          ----------------------------------------------------------------------
1q2lA1          ----------------------------------------------------------------------
1q2lA4          ----------------------------------------------------------------------
1ezvA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SRYDPPXXXXXXXXXXXXXXXXXSAQDGQPARNEAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXTASPER
1hr6A2          ----------------------------------------------------------------------
1hr6B2          ----------------------------------------------------------------------
2fgeA2          ----------------------------------------------------------------------
1bccB2          ----------------------------------------------------------------------
2fgeA3          ----------------------------------------------------------------------
1bccA1          SRYESEKNNGAGYFLEHLAFKG--------TKNRPQNALEKEVESMGAHLNAYSSREHTAYYIKALSKDV
1ezvA2          ----------------------------------------------------------------------
1hr6A1          SRFEGRNLKGCTHILDRLAFKSTEHVERAMAETLELLGGNYQCTSSRENLMYQAS---------VFNQDV
1bccB1          SRYENSSNLGTSHLLRLASSLTT---KGASSFKITRGIEAVGGKLSVESTRENMAYTVE-----CLRDDV
2fgeA4          FRTPPKDSTGIPHILQHSVLCGS---RKYPVKEPF--VELLKGSLHTFLNAFTYPDRTCYPVASTNTKDF
1ezvB1          SRYATKDGVAHLLNRFNFQ--------NTNTRSALKLVRESELLGGTFKSTLDREYITLKAT--FLKDDL
1q2lA1          KAMDSARNQVMFALNDYL------AGLALDQLSNQASVGGISFSTNANNGLMVNAN--------GYTQRL
1q2lA4          SLEDPEAYQGLAHYLEHMSLMG-------SKKYPQADSLAEYLKMHGGSHNASTAPYRTAFYLEVENDAL
2fgeA1          SLKHELLPLVPLFCQSLLEXGTKDLTFVQLNQLGRKTGGISVYPLTSSVRGKDEPCSKIIVRGKSXAGRA
1ezvA1          ----------------------------------------------------------------------
1bccA2          ----------------------------------------------------------------------
1hr6A2          ---------------------------------------------------------------------A
1hr6B2          ----------------------------------------------------------------------
1bccA1          ----------------------------------------------------------------------
1ezvA2          ----------------------------------------------------------------------
1hr6A1          ----------------------------------------------------------------------
1bccB1          ----------------------------------------------------------------------
2fgeA4          ----------------------------------------------------------------------
1ezvB1          ----------------------------------------------------------------------
1q2lA1          ----------------------------------------------------------------------
1q2lA4          ----------------------------------------------------------------------
1ezvA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EQSLRLAAQLIKSPTYPDAVVAREKQRLITAIREGDTRPGVIADKKLSKAIYPNHPYGVSATAETVGSIT
1hr6A2          ----------------------------------------------------------------------
1hr6B2          ----------------------------------------------------------------------
2fgeA2          ----------------------------------------------------------------------
1bccB2          ----------------------------------------------------------------------
2fgeA3          ----------------------------------------------------------------------
1bccA1          PKAVELLADIVQNCSLEDSQIEKERDVIVRELQENDTSMREVVFNYLHATAFQGTGLAQSVPSENIRKLS
1ezvA2          ----------------------------------------------------------------------
1hr6A1          GKMLQLMSETVRFPKITEQELQEQKLSAEYEIDEVWMKPELVLPELLHTAAYSGETLGSPCPRGLIPSIS
1bccB1          EILMEFLLNVTTAPEFRPWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYR-NALADSCPDYRIGKVT
2fgeA4          YNLVDVYLDAVFFPKCVDSEDISYKGVVFNEXKGVYSQPDNILGRIAQQALSPENTYGVDGDPKDIPNLT
1ezvB1          PYYVNALADVLYKTAFKPHELTESVLPAAYDYAVAEQCPVKSAEDQLYAITFRKGLGN-PLLYDGVERVS
1q2lA1          PQLFQALLEGYFSYTATEDQLEQAKSWYNQMMDSAEKGKAFEQAIMPAQMLSQVPYFSRDERRKILPSIT
1q2lA4          PGAVDRLADAIAEPLLDKKYAERERNAVNAELTMARTRDGMRMAQVSAETINPAHPGSLETLSDKPGNPV
2fgeA1          DDLFNLXNCLLQEVQFTD--QQRFKQFVSQSRARXENRLRGSGHGINIAGWXSEQXGGLSYFLHTLEKKV
1ezvA1          DKSLDFLNQSFKANLLSSSNFEATKKSVLKQVQEDNDHPNRVLEH-LHSTAFQNTPLSLPGTLESLENLV
1bccA2          ----------------------------------------------------------------------
1hr6A2          QQMYNTFANKDLRLT--EDEVSRAKNQLKSSLLMNLESKLVELEDMGRQVLMHGRKIPVNEMISKIEDLK
1hr6B2          VNEILKEWKRIKSGKISDAEVNRAKAQLKAALLLSLDGSTAIVEDIGRQVVTTGKRLSPEEVFEQVDKIT
1bccA1          ----------------------------------------------------------------------
1ezvA2          DDLIHFTLKQWNTISVTDTEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLAFKKIDAIT
1hr6A1          ----------------------------------------------------------------------
1bccB1          ----------------------------------------------------------------------
2fgeA4          ----------------------------------------------------------------------
1ezvB1          ----------------------------------------------------------------------
1q2lA1          ----------------------------------------------------------------------
1q2lA4          ----------------------------------------------------------------------
1ezvA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           HDDLVKFWQDNYTAKRAVVTLIGAIDRKQAEQIAEELTRGLPAGAAPPTMPDVQMTIPASEQRIPHPAQQ
1hr6A2          -----------------------------------------------------------GESCIPPLPEL
1hr6B2          ----------------------------------------------------------RGERFIKENLPT
2fgeA2          --------------------------------------------------------LPLRNEAIVIPTQV
1bccB2          -----------------------------------------------------------GEIREQNGDSL
2fgeA3          ----------------------------------------------KLFSEPVRLVEKYPAGRDGDLKKK
1bccA1          RADLTEYLSTHYTAPRMVLAAAGGVEHQQLLELAQKHFGGVPFTYDDDAVPTL-----------------
1ezvA2          -----------------------------------------------------------SEVRLRDTLPK
1hr6A1          KYYLLDYRNKFYTPENTVAAFVG-VPHEKALELTGKYLGDWQSTHPPI----------------------
1bccB1          SVELHDFVQNHFTSARMALVGLG-VSHPVLKNVAEQLLNIRGGLGLSGA---------------------
2fgeA4          FEEFKEFHRQYYHPSNARIWFYGDDDPVHRLRVLSEYLDXFEASPSPNS---------------------
1ezvB1          LQDIKDFADKVYTKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLV----------------------
1q2lA1          LKEVLAYRDALKSGARPEFMVIGNMTEAQATTLARDVQKQLGADGSE-----------------------
1q2lA4          QQALKDFHEKYYSANLMKAVIYSNKPLPELAKMAADTFGRVPNKESK-----------------------
2fgeA1          DEDWEEIRRSLLARNGCIVNXTADGSLTNVEKSVAKFLDLLPENPSGG----------------------
1ezvA1          VADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTGTKP-----------------------
1bccA2          ---------------------------------------------------------------------L
1hr6A2          PDDISRVAEMIFTGNVNNAGNGKGRATVVMQGDRGSF---------------------------------
1hr6B2          KDDIIMWANYRLQNKPVSMVALGNTSTVPNVSYIEE----------------------------------
1bccA1          ----------------------------------------------------------------------
1ezvA2          VKDVKAWAGKRLWDQDIAIAGTGQIEGLLDYMRIRS----------------------------------
1hr6A1          ---------------------------------------------------------------SNTPGHF
1bccB1          ----------------------------------------------------------------------
2fgeA4          ----------------------------------------------------------------------
1ezvB1          ----------------------------------------------------------------------
1q2lA1          ----------------------------------------------------------------------
1q2lA4          ----------------------------------------------------------------------
1ezvA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ASVALGQPAIARGDPDYFPXXXXXXXXXXXXFSSRLTDQVREKRGLTYGVDSYFSPSKQPGPFSVSLQTK
1hr6A2          FHIQIGFEGLPIDHPDIYALATLQTLLGGGGMYSRLYTHVLNQYYFVENCVAFNHSYSDSGIFGISLSCI
1hr6B2          THIAIALEGVSWSAPDYFVALATQAIVGNWDSPSPLAVAASQNGSLANSYMSFSTSYADSGLWGMYIVTD
2fgeA2          NYVGKAGNIYSTGYELDGSAYVISKHIS----NTWLWDRVRVSGG-AYGGFCDFDSHSGVFSYLSYRDPN
1bccB2          VHAAIVAESAAIGGAEANAFSV---------LQHVLGANPHVKRGNPFDVSAFNASYSDSGLFGFYTISQ
2fgeA3          HXLCVNWSEKPLDLQTQLALGFLDHLXLGT-PASPLRKILLESGLGEALVSSGLSDELLQPQFGIGLKVS
1bccA1          ----------------------------------------------------------------------
1ezvA2          AWISLAVEGEPVNSPNYFVAKLAAQIFGSYNQGIKLLDNIQEY-QLCDNFNHFSLSYKDSGLWGFSTATN
1hr6A1          ----------------------------------------------------------------------
1bccB1          ----------------------------------------------------------------------
2fgeA4          ----------------------------------------------------------------------
1ezvB1          ----------------------------------------------------------------------
1q2lA1          ----------------------------------------------------------------------
1q2lA4          ----------------------------------------------------------------------
2fgeA1          ----------------------------------------------------------------------
1ezvA1          ----------------------------------------------------------------------
1bccA2          AHVAIAVEGPGWAHPDLVALQVANAIIGHYDRSSSPLASIAVTNKLCQSFQTFSICYSETGLFGFYFVCD
1hr6A2          ----------------------------------------------------------------------
1hr6B2          ----------------------------------------------------------------------
1bccA1          --------------------------------------------------------------TAYYIKAL
1ezvA2          ----------------------------------------------------------------------
1hr6A1          SALGLYIDAGSRFEGRNLKGCTHILDRLAFKSTEHVEGRAMAETLELLGGNYQCTSSREN--LMYQASVF
1bccB1          --------------------------------------------------------------MAYTVECL
2fgeA4          ----------------------------------------------------------------------
1ezvB1          --------------------------------------------------------------ITLKATFL
1q2lA1          -----------------------------------------SVGGISFSTNANNG-------LMVNANGY
1q2lA4          ----------------------------------------------------------------------
1ezvA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           KENTNEALALVREIVAKYVAEGPTDAELRAAKDNLVNGFPLRIDSNRKLLTNVANIGWYGLPLDYLDTWT
1hr6A2          PQAAPQAVEVIAQQTFANKDLRLTEDEVSRAKNQLKSSLLMNLESKLVELEDMGRQVLMHGRKIPVNEMI
1hr6B2          SNNVRLIVNEILKEWKRIKSGKISDAEVNRAKAQLKAALLLSLDGSTAIVEDIGRQVVTTGKRLSPEEVF
2fgeA2          LL---KTLDIYDGTGDFLRGLDVDQETLTKAIIGTIGDVDSYQLPDAKGYSSLLRHL-LGVTDEERQRKR
1bccB2          AAYAGQVIKAAYNQVKTIAQGNVSNENVQAAKNKLKAKYLMSVESSEGFLEEVGSQALAAGSYNPPSTVL
2fgeA3          EENVQKVEELIXDTLKKLAEEGFDNDAVEASXNTIEFSLRENNTGSFPLXLQSISKWIYDXDPPLKALKT
1bccA1          ----------------------------------------------------------------------
1ezvA2          VTMIDDLIHFTLKQWNRL-TISVTDTEVERAKSLLKLQLGQLYESGNPVNNLLGAEVLIKGSKLSLGEAF
1hr6A1          ----------------------------------------------------------------------
1bccB1          ----------------------------------------------------------------------
2fgeA4          ----------------------------------------------------------------------
1ezvB1          ----------------------------------------------------------------------
1q2lA1          ----------------------------------------------------------------------
1q2lA4          ----------------------------------------------------------------------
2fgeA1          ----------------------------------------------------------------------
1ezvA1          ----------------------------------------------------------------------
1bccA2          RMSIDDMMFVLQGQWMR-LCTSISESEVLRGKNFLRNALVSHLDGTTPVCEDIGELLTYGRRIP-LEEWE
1hr6A2          ----------------------------------------------------------------------
1hr6B2          ----------------------------------------------------------------------
1bccA1          SKDVPKAVELLADIVQN-----CEDSQIEKERDVIVRELQENDTSMREVVFNLHATAFQGTGLAQSVEPS
1ezvA2          ----------------------------------------------------------------------
1hr6A1          NQDVGKMLQLMSETVRFPKI---TEQELQEQKLSAEYEIDEVWMKPELVLPELLHTAAYGETLGSPLIPR
1bccB1          RDDVEILMEFLLNVTTA-----PRPWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALADLYCPD
2fgeA4          --------------------------------------------------------------------DP
1ezvB1          KDDLPYYVNALADVLYK-----TAPHELTESVLPAARYDYAVAEQCKSAEDQLYAITFRKGLGNPL--LY
1q2lA1          TQRLPQLFQALLEGYFSYT---ATEDQLEQAKSWYNQMMDSAEKGKAFEQAIMPAQMLSQVPYFSRDERR
1q2lA4          -----------------------------------------------------------------LETLS
1ezvA1          PGSTDKSLDFLNQSFIQQKANLLSSSNFEATKKSVLKQVQDFEDNDHPVLEHLHSTAFQNTPLSLTRGTL


                         .         .         +         .         .         .         .:490
query           SQINKVTREQVRAAFQRHVHPDAMATVIVGGPEK
1hr6A2          SKIEDLKPDDISRVAEMIFTGNVNNAGNGKGRAT
1hr6B2          EQVDKITKDDIIMWANYRLQNKPVSMVALG----
2fgeA2          EEILTTSLKDFKDFAQAIDVVDKGVAVAVASAED
1bccB2          QQIDAVADADVIKAAKKFVSRQ-KSMAASG----
2fgeA3          RIAEEGSKAVFSPLIEKLILNNSHRVTIEXQPDP
1bccA1          ----------------------------------
1ezvA2          KKIDAITVKDVKAWAGKRLWDQDIAIAGTG----
1hr6A1          ----------------------------------
1bccB1          ----------------------------------
2fgeA4          ----------------------------------
1ezvB1          ----------------------------------
1q2lA1          ----------------------------------
1q2lA4          ----------------------------------
2fgeA1          ----------------------------------
1ezvA1          ----------------------------------
1bccA2          ERLAEVDARMVREVCSKYIY-DQCPAVAGPGP--
1hr6A2          ----------------------------------
1hr6B2          ----------------------------------
1bccA1          ENIRKLSRADLTEYLSTHYTAPRMVLAAAG----
1ezvA2          ----------------------------------
1hr6A1          GLIPSISKYYLLDYRNKFYTPENTVAAFVG----
1bccB1          YRIGKVTSVELHDFVQNHFTSARMALVGLG----
2fgeA4          KDIPNLTFEEFKEFHRQYYHPSNARIWFYG----
1ezvB1          DGVERVSLQDIKDFADKVYTKENLEVSGEN----
1q2lA1          KILPSITLKEVLAYRDALKSGARPEFMVIG----
1q2lA4          DKPGNPVQQALKDFHEKYYSANLMKAVIYS----
1ezvA1          ESLENLVVADLESFANNHFLNSNAVVVGTGN---