[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF07698.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1fd9A.bssp"
#ERROR : Can't open dsspfile "1u79A.bssp"
#ERROR : Can't open dsspfile "1jvwA.bssp"
#ERROR : Can't open dsspfile "1kt0A3.bssp"
#ERROR : Can't open dsspfile "1a7xA.bssp"
#ERROR : Can't open dsspfile "1q6hA.bssp"
#ERROR : Can't open dsspfile "1kt0A2.bssp"
#ERROR : Can't open dsspfile "1hxvA.bssp"
#ERROR : Can't open dsspfile "1t11A3.bssp"
#ERROR : Can't open dsspfile "1ix5A.bssp"

## Summary of PDB Search
:115
    9e-32  40%  1fd9A  [d.26.1.1] PROTEIN (MACROPHAGE INFECTIVITY POTENTIATOR
    4e-31  50%  1u79A  [d.26.1.1] FKBP-TYPE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE 3
    1e-29  46%  1jvwA  [d.26.1.1] MACROPHAGE INFECTIVITY POTENTIATOR
    5e-29  25%  1kt0A3 [d.26.1.1] 51 KDA FK506-BINDING PROTEIN A:139 -- 253
    2e-28  54%  1a7xA  [d.26.1.1] FKBP12
    1e-27  44%  1q6hA  [d.26.1.1] FKBP-TYPE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE
    3e-25  47%  1kt0A2 [d.26.1.1] 51 KDA FK506-BINDING PROTEIN A:33 -- 138
    3e-24  23%  1hxvA  [d.26.1.1] TRIGGER FACTOR
    5e-23  24%  1t11A3 [d.26.1.1] TRIGGER FACTOR A:135 -- 247
    5e-23  34%  1ix5A  [d.26.1.1] FKBP
:115

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQTTPSGLQFEDTVVGSGDEAKAGKHVTVHYTGWLFENGQAGRKFDSSKDRNDPFVFPLGAGHVIRGWDE
1fd9A           VVVLPSGLQYKVINSGNGVKPGKSDTVTVEYTGRLID----GTVFDSTEKTGKPATF--QVSQVIPGWTE
1u79A           FSVSPSGLAFCDKVVGYGPEAVKGQLIKAHYVGKLEN----GKVFDSSYNRGKPLTFRIGVGEVIKGWDQ
1jvwA           --KLPSGLVFQRIARGSGKRPAIDDKCEVHYTGRLRD----GTVFDSSRERGKPTTF--RPNEVIKGWTE
1kt0A3          --FEDGGIIRRTKRKGEGYSPNEGATVEIHLEGRC-----GGRMFDCRDVAFTVGEG--EDHDIPIGIDK
1a7xA           ------GVQVETISPGDGRTPKRGQTCVVHYTGMLED----GKKFDSSRDRNKPFKFMLGKQEVIRGWEE
1q6hA           VKTSSTGLVYQVVEAGKGEAPKDSDTVVVNYKGTL-IDGK---EFDNSYTRGEPLSF--RLDGVIPGWTE
1kt0A2          --------------VLKIVTPMIGDKVYVHYKGKLF---------------DSPFVFSLGKGQVIKAWDI
1hxvA           -------------------KLANGDIAIIDFTGIV-----DNKKLASASAQ--NYELTIGSNSFIKGFET
1t11A3          --EMLETLRKQQATWKEVDEAENGKRVSIDFVGSI-----DGVEFEGGKAE--NFPLEMGAGRMIPGFED
1ix5A           ---------------------DKGVKIKVDYIGKL----ESGDVFDTSIEEVEPLEFVVGEGQLIQGFEE


                         .         .         *         .         .         .         .:140
query           GVQGMKVGGTRRLVIPADLGYGARGAGGVIPPNATLLFEVELLAV
1fd9A           ALQLMPAGSTWEIYVPSGLAYGPRSVGGPIGPNETLIFKIHLISV
1u79A           GILGMLTGGKRTLRIPPELAYGDRGAGCLIPPASVLLFDIEYIGK
1jvwA           ALQLMREGDRWRLFIPYDLAYGVTGGGGMIPPYSPLEFDVELISI
1kt0A3          ALEKMQREEQCILYLGPRYGFGEAGKPKFIEPNAELIYEVTLKSF
1a7xA           GVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKL
1q6hA           GLKNIKKGGKIKLVIPPELAYGKAGV-PGIPPNSTLVFDVELLDV
1kt0A2          GVATMKRGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDF
1hxvA           GLIAMKVNQKKTLALTFPSDYHVKE-----LQSKPVTFEVVLKAI
1t11A3          GIVGKTKGMEFVIDVTFPEDYHAE-----NLKGKAAKFAIKVNKV
1ix5A           AVLDMEVGDEKTVKIPAEKAYGNRNEMLIIPRDAFKEADFEPE--