[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF07717.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1riqA2.bssp"
#ERROR : Can't open dsspfile "1riqA1.bssp"
#ERROR : Can't open dsspfile "1xfiA.bssp"
#ERROR : Can't open dsspfile "1v4pA.bssp"
#ERROR : Can't open dsspfile "1nyqA3.bssp"
#ERROR : Can't open dsspfile "1kx8A.bssp"
#ERROR : Can't open dsspfile "2e1bA2.bssp"
#ERROR : Can't open dsspfile "1k8kD1.bssp"
#ERROR : Can't open dsspfile "1c0aA3.bssp"
#ERROR : Can't open dsspfile "2e1bA1.bssp"
#ERROR : Can't open dsspfile "2b5dX2.bssp"
#ERROR : Can't open dsspfile "1jrmA.bssp"

## Summary of PDB Search
:884
    e-130  63%  1riqA2 [d.104.1.1] ALANYL-TRNA SYNTHETASE A:1 -- 236
    7e-69  41%  1riqA1 [a.203.1.1] ALANYL-TRNA SYNTHETASE A:237 -- 457
    4e-56  12%  1xfiA  [e.50.1.1] UNKNOWN PROTEIN
    1e-37  27%  1v4pA  [d.67.1.2] ALANYL-TRNA SYNTHETASE
    4e-35  23%  1nyqA3 [d.67.1.1] THREONYL-TRNA SYNTHETASE 1 A:63 -- 241
    6e-32  14%  1kx8A  [a.118.21.1] CHEMOSENSORY PROTEIN A6
    9e-32  30%  2e1bA2 [d.67.1.2] 216AA LONG HYPOTHETICAL ALANYL-TRNA SYNTHETASE
    5e-27  13%  1k8kD1 [d.198.2.1] ARP2/3 COMPLEX 34 KDA SUBUNIT D:1 -- 120
    4e-23  10%  1c0aA3 [d.104.1.1] ASPARTYL TRNA SYNTHETASE A:107 -- 287 A:421 --
    1e-14  26%  2e1bA1 [b.43.3.6] 216AA LONG HYPOTHETICAL ALANYL-TRNA SYNTHETASE
    5e-13   5%  2b5dX2 [c.6.2.4] ALPHA-AMYLASE X:1 -- 404
    2e-10  15%  1jrmA  [d.206.1.1] CONSERVED HYPOTHETICAL PROTEIN MTH637
:884

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxRRRLRPHNMKVSDIRSKFLQFFESKGHTVVRSSSLVPANDPTLLFTNSGMVQFKDVFLGTDKRPYVRA
1riqA2          ---------SLSAHEIRELFLSFFEKKGHTRVKSAPLVPENDPTLLFVNAGXVPFKNVFLGLEKRPYKRA
1riqA1          ----------------------------------------------------------------------
1xfiA           -------------EKFAERYAGILEDLKKDPESHGGPPDGILLCRLREQVLELGFRDIFKKVKDEENAKA
1v4pA           ----------------------------------------------------------------------
1nyqA3          ----------------------------------------------------------------------
1kx8A           ----------------------------------------------------------------------
2e1bA2          ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1c0aA3          --RRPEMAQRLKTAKITSLVRRFMDDHGFLDIETPMLTKATPERDYLVPSRVHKGKFYALPQSPQLFKQL
2e1bA1          ----------------------------------------------------------------------
2b5dX2          ---------------------------------------------YLAQNNVEYFFVDSHAFWFADEQPR
1jrmA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TSSQRSVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKREAIQYAWELLTKVYQLPADKLWVTVYA
1riqA2          TSCQKCLRVSGKHNDLEQVGYTSRHHTFFEXLGNFSFGDYFKKEAIEYAWEFVTEVLKLPKEKLYVSVYK
1riqA1          ----------------------------------------------------------------------
1xfiA           ISLFPQVVS--LSDAIEDDGKRLENLVRGIFAGNFMSFLASCQNLVPRPWVIDDLENFQWINKSWKKAVI
1v4pA           ----------------------------------------------------------------------
1nyqA3          ----------------------------------------------------------------------
1kx8A           ----------------------------------------------------------------------
2e1bA2          ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1c0aA3          LMMSGFDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQALVRHLWLEVKGVDLGDDKPDLRDESK
2e1bA1          ----------------------------------------------------------------------
2b5dX2          YGVYRPIMTPSGVFAFARDPESSEQVWSAAVGYPGDPRYREFYRDIGFDRE----------MEYIKDYID
1jrmA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EDDEAYDIWAKEVGVPADRIVRIGDNKGARYASDNFWQMADTGPCGPCSEIFYDHGPDVWXXXXXXXXXX
1riqA2          DDEEAYRIWNEHIGIPSERIWRLGE-------EDNFWQXGDVGPCGPSSEIYVDRGEEY---------EG
1riqA1          ----------------------------------------------------------------------
1xfiA           FVDNSGADIILGILPFARELLR-RGAQVVLAANELPSINDITCTELTEILSQLKNGQ-------------
1v4pA           ----------------------------------------------------------------------
1nyqA3          ----------------------------------------------------------------------
1kx8A           ----------------------------------------------------------------------
2e1bA2          ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1c0aA3          WAPLWVIDFPMFEDDGEGGLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGD
2e1bA1          ----------------------------------------------------------------------
2b5dX2          PSGVRINTGIKYHRITSKSLDASQKEYYDIDAMEAVEEHARDFLHKKESQARRLMDIMGVEPVIVAPFDA
1jrmA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXRYIEIWNLVFMQFNRDEQGTMTPLPKPCVDTGMGLERIAAVLQHVHSNYEIDLFQALIKGAGRETHIA
1riqA2          DERYLEIWNLVFXQYNRDENGVLTPLPHPNIDTGXGLERIASVLQGKNSNF-------------------
1riqA1          ---------------------------------------------------EIDIIFPLIQFGGKKYGEK
1xfiA           --------------LLGVDTSKLLIANSGNDLPVIDLSRVSQELAYLSSDADLVIVEGMGRGIETNLYAQ
1v4pA           ----------------------------------------------------------------------
1nyqA3          ----------------------------------------------------------------------
1kx8A           ----------------------------------------------------------------------
2e1bA2          ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1c0aA3          MQQTVFGILGINEEEQRFLLDALKYGTPPHAGLAFGLDRLTMLLTGTDNIRDVIAFPKTTAAACLMTEAP
2e1bA1          ----------------------------------------------------------------------
2b5dX2          E-LFGHWWFEGVFFLKRFFELV---NESKDLKLV----TASEVIDTLEEVQIATPAD-------------
1jrmA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           DLNQNSLKVIADHIRACSFLIVDGVIPGNEGRGYVLRRIVRRAIRHGYKLGQKTPFFHKLVGDLVAQMGE
1riqA2          ----------------------------------------------------------------------
1riqA1          FETDVALRVIADHLRAITFAISDGVIPSNEGRGYVIRRILRRAXRFGYKLGIENPFLYKGVDLVVDIXKE
1xfiA           FKCDSLKIGMVKHLEVAEFLGGR-----------------------------------------------
1v4pA           ----------------------------------------------------------------------
1nyqA3          ----------------------------------------------------------------------
1kx8A           ---------------------------------------------NLDEILANKRLLVAYV-NCVMERGK
2e1bA2          ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1c0aA3          SF------ANPTALAE------------------------------------------------------
2e1bA1          ----------------------------------------------------------------------
2b5dX2          ----------------------------------------------------------------------
1jrmA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AYPELAEAQSRVVEVLKAEEERFFETIENGMSILDAAVADLKAKGGKVLDGELAFKLHDTFGFPLDLTQD
1riqA2          ----------------------------------------------------------------------
1riqA1          PYPELELSREFVKGIVKGEEKRFIKTLKAGXEYIQEVIQKALEEGRKTLSGKEVFTAYDTYGFPVDLIDE
1xfiA           ----------------------------------------------------------------------
1v4pA           ----------------------------------------------------------------------
1nyqA3          ----------------------------------------------------------------------
1kx8A           CSPEGKELKEHLQDAIENGCKKCTENQEKGAYRVIEHLIK-----NEIEIWRELTAKYDPTGNWRKKYED
2e1bA2          ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1c0aA3          ----------------------------------------------------------------------
2e1bA1          ----------------------------------------------------------------------
2b5dX2          ----------------------------------------------------------------------
1jrmA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           VAREQEITVDEAAFDAAMTRQREQARAAGKFKMAAGLEYSGEKTVFHGYDALSMDGVRVTALYVDGASVD
1riqA2          ----------------------------------------------------------------------
1riqA1          IAREKGLGIDLEGFQCELEEQRERARKHPVYS---HLKELGKTSAFVGAAAL------------------
1xfiA           ----------------------------------------------------------------------
1v4pA           ----------------------------------------------------------------------
1nyqA3          ----------------------------------------------------------------------
1kx8A           RAKAAGIVI-------------------------------------------------------------
2e1bA2          ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1c0aA3          ----------------------------------------------------------------------
2e1bA1          ------------------------------------------MTRKLYYEDAYLKE-----------AKG
2b5dX2          ----------------------------------------------------------------------
1jrmA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           TMQPGQSGVVVLDNTPFYAESGGQVGDQGTLVSGPAVFAVADTTKIQSDVFGHQGTLANGALKVGxxxxx
1riqA2          ----------------------------------------------------------------------
1riqA1          ----------------------------------------------------------------------
1xfiA           ----------------------------------------------------------------------
1v4pA           ----------------------------------------------------------------------
1nyqA3          ----------------------------------------------------------------------
1kx8A           ----------------------------------------------------------------------
2e1bA2          ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1c0aA3          ----------------------------------------------------------------------
2e1bA1          RVLEIRDNAILLDQTIFYPTGGGQPHDRGTIN----GVEVLDVYKDEEGNVWH-VVKEPEKFKVG-----
2b5dX2          ----------------------------------------------------------------------
1jrmA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxNHSATHLMHKALREVLGTHVQQKGSLVDPDKTRFDFSHNAPLTDAQIRQIEEIVNAEI
1riqA2          ----------------------------------------------------------------------
1riqA1          ----------------------------------------------------------------------
1xfiA           ----------------------------------------------------------------------
1v4pA           ------------THSALHVVKGAVVKVLGSEAWTYSTYVKGNKGVLIVKFDRKPSDEEIREIERLANEKV
1nyqA3          ------------RHSTAHLMAHAIKRLYGNVKFGVGPVIE-GGFYYDFDIDQNISSDDFEQIEKTMKQIV
1kx8A           ----------------------------------------------------------------------
2e1bA2          ------------IHTGLHLLEHVLNEVLGEGNQLVGSGMSVEKGRYDIAYPENLNKYK-EQIISLFNKYV
1k8kD1          -----------------LLEVRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLY----HISNPNGDKT
1c0aA3          ----------------------------------------------------------------------
2e1bA1          ----------------------------------------------------------------------
2b5dX2          ----------------------------------------------------------------------
1jrmA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           LSNAPTVAQVMPFDDAVKSGAMALFGEKYADDVRVLSIGTSKELCGGTHVTRTGDIGLFKIVVEAGVAAG
1riqA2          ----------------------------------------------------------------------
1riqA1          ----------------------------------------------------------------------
1xfiA           ----------------------------------------------------------------------
1v4pA           KENAPIKIYELPREEAEKFGEDMYDLFPVPEDVRILKVDWNVNACNKEHTKTTGEIGPIKIRVRFRKSKG
1nyqA3          NENMKIERKVVSRDEAKELFSNDEYKAIPEDENVTLYSGDFTDLCRGVHVPSTAKIKEFKLLSTAGAYSN
1kx8A           ----------------------------------------------------------------------
2e1bA2          DEG----------------GEVKIWWEGD---RRYTQIRFEVIPCGGTHVKDIKEIGHIKKLKRSSIGRG
1k8kD1          KVMVSI--SLKFYKELQAHGADELLKRVYGSYLVNPESGYDLENLPASKDSIVHQAGMLKR---------
1c0aA3          ----------------------------------------------------------------------
2e1bA1          ----------------------------------------------------------------------
2b5dX2          ----------------------------------------------------------------------
1jrmA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           IRRVEAITGDNALHYLQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1riqA2          ----------------------------------------------------------------------
1riqA1          ----------------------------------------------------------------------
1xfiA           ----------------------------------------------------------------------
1v4pA           LLEIHFE---------------------------------------------------------------
1nyqA3          NKMLQRIYGTAFFDKKE-----------------------------------------------------
1kx8A           ----------------------------------------------------------------------
2e1bA2          KQRLEM----------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1c0aA3          ----------------------------------------------------------------------
2e1bA1          ----------------------------------------------------------------------
2b5dX2          ----------------------------------------------------------------------
1jrmA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           AAQAVDVKGLKVLAAQLDGADVKTLRETMDKLKDKLQSAAIVLAAVADGKVSLIAGVTADATSKVKAGEL
1riqA2          ----------------------------------------------------------------------
1riqA1          ----------------------------------------------------------------------
1xfiA           ----------------------------------------------------------------------
1v4pA           ----------------------------------------------------------------------
1nyqA3          ----------------------------------------------------------------------
1kx8A           ----------------------------------------------------------------------
2e1bA2          ----------------------------------------------------------------------
1k8kD1          ----------------------------------------------------------------------
1c0aA3          ----------------------------------------------------------------------
2e1bA1          ----------------------------------------------------------------------
2b5dX2          ----------------------------------------------------------------------
1jrmA           YNEWRKRIEVKIHSPPQKG---KANREIIKEFSETFGRDVEIVSQKSRQKTIRIQGMGRDLFLKLVSEKF


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1riqA2          --------------------------------------------
1riqA1          --------------------------------------------
1xfiA           --------------------------------------------
1v4pA           --------------------------------------------
1nyqA3          --------------------------------------------
1kx8A           --------------------------------------------
2e1bA2          --------------------------------------------
1k8kD1          --------------------------------------------
1c0aA3          --------------------------------------------
2e1bA1          --------------------------------------------
2b5dX2          --------------------------------------------
1jrmA           --------------------------------------------