[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF07787.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3c07A1.bssp"
#ERROR : Can't open dsspfile "2g7sA1.bssp"
#ERROR : Can't open dsspfile "1z77A1.bssp"
#ERROR : Can't open dsspfile "2hkuA1.bssp"
#ERROR : Can't open dsspfile "2oi8A1.bssp"
#ERROR : Can't open dsspfile "2g3bA1.bssp"
#ERROR : Can't open dsspfile "2genA1.bssp"
#ERROR : Can't open dsspfile "2g7lA1.bssp"
#ERROR : Can't open dsspfile "2hyjA1.bssp"
#ERROR : Can't open dsspfile "1sgmA1.bssp"
#ERROR : Can't open dsspfile "2fq4A1.bssp"
#ERROR : Can't open dsspfile "1a6iA1.bssp"
#ERROR : Can't open dsspfile "1v7bA1.bssp"
#ERROR : Can't open dsspfile "2fbqA1.bssp"
#ERROR : Can't open dsspfile "1ui5A1.bssp"
#ERROR : Can't open dsspfile "2i10A1.bssp"
#ERROR : Can't open dsspfile "1rktA1.bssp"
#ERROR : Can't open dsspfile "1t56A1.bssp"
#ERROR : Can't open dsspfile "1vi0A1.bssp"
#ERROR : Can't open dsspfile "2np5A1.bssp"
#ERROR : Can't open dsspfile "1zk8A1.bssp"
#ERROR : Can't open dsspfile "2fd5A1.bssp"
#ERROR : Can't open dsspfile "2iu5A1.bssp"
#ERROR : Can't open dsspfile "2np3B1.bssp"
#ERROR : Can't open dsspfile "1jt0A1.bssp"
#ERROR : Can't open dsspfile "1t33A1.bssp"
#ERROR : Can't open dsspfile "2o7tA1.bssp"
#ERROR : Can't open dsspfile "2d6yA1.bssp"
#ERROR : Can't open dsspfile "1pb6A1.bssp"
#ERROR : Can't open dsspfile "2g7gA1.bssp"
#ERROR : Can't open dsspfile "2id3A1.bssp"
#ERROR : Can't open dsspfile "2gfnA1.bssp"

## Summary of PDB Search
:236
    2e-16  33%  3c07A1 [a.4.1.9] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    6e-16  23%  2g7sA1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR, TETR FAMILY A:3 -- 76
    1e-14  23%  1z77A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR (TETR FAMILY) A:1 --
    6e-14  25%  2hkuA1 [a.4.1.9] A PUTATIVE TRANSCRIPTIONAL REGULATOR A:18 -- 87
    8e-14  18%  2oi8A1 [a.4.1.9] PUTATIVE REGULATORY PROTEIN SCO4313 A:8 -- 86
    1e-13  25%  2g3bA1 [a.4.1.9] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    1e-13  31%  2genA1 [a.4.1.9] PROBABLE TRANSCRIPTIONAL REGULATOR A:6 -- 75
    1e-13  22%  2g7lA1 [a.4.1.9] TETR-FAMILY TRANSCRIPTIONAL REGULATOR A:16 -- 83
    2e-13  26%  2hyjA1 [a.4.1.9] PUTATIVE TETR-FAMILY TRANSCRIPTIONAL REGULATOR
    2e-13  22%  1sgmA1 [a.4.1.9] PUTATIVE HTH-TYPE TRANSCRIPTIONAL REGULATOR YXAF
    3e-13  26%  2fq4A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR, TETR FAMILY A:9 -- 77
    3e-13  23%  1a6iA1 [a.4.1.9] TETRACYCLINE REPRESSOR PROTEIN CLASS D A:2 -- 67
    4e-13  18%  1v7bA1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:1 -- 74
    4e-13  27%  2fbqA1 [a.4.1.9] PROBABLE TRANSCRIPTIONAL REGULATOR A:2 -- 80
    4e-13  27%  1ui5A1 [a.4.1.9] A-FACTOR RECEPTOR HOMOLOG A:5 -- 75
    4e-13  25%  2i10A1 [a.4.1.9] PUTATIVE TETR TRANSCRIPTIONAL REGULATOR A:10 --
    6e-13  19%  1rktA1 [a.4.1.9] PROTEIN YFIR A:2 -- 82
    8e-13  17%  1t56A1 [a.4.1.9] ETHR REPRESSOR A:22 -- 94
    8e-13  27%  1vi0A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:6 -- 77
    8e-13  19%  2np5A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:9 -- 77
    1e-12  19%  1zk8A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR, TETR FAMILY A:6 -- 77
    1e-12  26%  2fd5A1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:1 -- 76
    1e-12  17%  2iu5A1 [a.4.1.9] HYPOTHETICAL PROTEIN YCEG A:1 -- 71
    4e-12  17%  2np3B1 [a.4.1.9] PUTATIVE TETR-FAMILY REGULATOR B:35 -- 99
    2e-11  43%  1jt0A1 [a.4.1.9] HYPOTHETICAL TRANSCRIPTIONAL REGULATOR IN QACA
    8e-11  18%  1t33A1 [a.4.1.9] PUTATIVE TRANSCRIPTIONAL REPRESSOR (TETR/ACRR
    2e-10  17%  2o7tA1 [a.4.1.9] TRANSCRIPTIONAL REGULATOR A:1 -- 78
    3e-10  17%  2d6yA1 [a.4.1.9] PUTATIVE TETR FAMILY REGULATORY PROTEIN A:7 --
    5e-10  25%  1pb6A1 [a.4.1.9] HYPOTHETICAL TRANSCRIPTIONAL REGULATOR YCDC A:14
    2e-09  20%  2g7gA1 [a.4.1.9] RHA04620, PUTATIVE TRANSCRIPTIONAL REGULATOR A:9
    3e-08  12%  2id3A1 [a.4.1.9] PUTATIVE TRANSCRIPTIONAL REGULATOR A:13 -- 80
    8e-04  25%  2gfnA1 [a.4.1.9] HTH-TYPE TRANSCRIPTIONAL REGULATOR PKSA RELATED
:236

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxAKPQAGPRRTRDRILDVSLRLFNELGEPNVTTTTIAEAMEISPGNLYYHFRNKDDIINSIFVRFEQEM
3c07A1          ---------EQTRALILETAXRLFQERGYDRTTXRAIAQEAGVSVGNAYYYFAGKEHLIQGFYDRIAAEH
2g7sA1          --------PQSKADDILQCARTLIIRGGYNSFSYADISQVVGIRNASIHHHFPSKSDLVCKLVSQYRQEA
1z77A1          -----------KRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYXSVTEKL
2hkuA1          ----------QTRDALFTAATELFLEHGE-GVPITQICAAAGAHPNQVTYYYGSKERLFVEVACAAVLRA
2oi8A1          ---PRERYRTQVRAEIKDHAWEQIATAGASALSLNAIAKRXGXSGPALYRYFDGRDELITELIRDAYRSQ
2g3bA1          ----------ERRDAILKASATAIAQRGIRGLRVNDVAEVAGVSPGLLYYHFKDRIGLLEAALNYINDRA
2genA1          ------------KDEILQAALACFSEHGVDATTIEXIRDRSGASIGSLYHHFGNKERIHGELYLAGIGQY
2g7lA1          --------PALSRRWIVDTAVALXRAEGLEKVTXRRLAQELDTGPASLYVYVANTAELHAAVLDALLGEV
2hyjA1          ------AEAQATRGRILGRAAEIASEEGLDGITIGRLAEELEMSKSGVHKHFGTKETLQISTLDKAFVDF
1sgmA1          ----------DSREKILHTASRLSQLQGYHATGLNQIVKESGAPKGSLYHFFPNGKEELAIEAVTYTGKI
2fq4A1          ---------IETQKAILSASYELLLESGFKAVTVDKIAERAKVSKATIYKWWPNKAAVVXDGFLSAAAAR
1a6iA1          ---------RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDALAVEILARH
1v7bA1          ---------TSKKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDW
2fbqA1          -------AQSETVERILDAAEQLFAEKGFAETSLRLITSKAGVNLAAVNYHFGSKKALIQAVFSRFLGPF
1ui5A1          --------AEQTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAAKEDLAHAILEIQSRTS
2i10A1          ------------DQVALQTAXELFWRQGYEGTSITDLTKALGINPPSLYAAFGSKRDLFEKTLDRYXCER
1rktA1          --KVTKEHKDKRQAEILEAAKTVFKRKGFELTTXKDVVEESGFSRGGVYLYFSSTEEXFRRIIETGLDEG
1t56A1          -----------RELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQA
1vi0A1          --------PKYXQ--IIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKEKXGQF
2np5A1          -----------SPERLAAALFDVAAESGLEGASVREVAKRAGVSIGAVQHHFSTKDEXFAFALRTLVDKL
1zk8A1          ----------LTLQKIVETAAEIADANGVQEVTLASLAQTLGVRSPSLYNHVKGLQDVRKNLGIYGIKKL
2fd5A1          --------KTQTRARILGAATQALLERGAVEPSVGEVMGAAGLTVGGFYAHFQSKDALMLEAFEQ-----
2iu5A1          --------SIITQKIIAKAFKDLMQSNAYHQISVSDIMQTAKIRRQTFYNYFQNQEELLSWIFENDFAEL
2np3B1          ---------------ILTAARVCFAERGFDATSLRRIAETAGVDQSLVHHFYGTKENLFLQALELPGKIE
1jt0A1          -----------LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENL------------
1t33A1          --------GEQAKSQLIAAALAQFGEYGL-HATTRDIAALAGQNIAAITYYFGSKEDLYLACAQWIADFL
2o7tA1          ---------LKRREHIITTTCNLYRTHHHDSLTXENIAEQAGVGVATLYRNFPDRFTLDXAC---AQYLF
2d6yA1          ----------ATKARIFEAAVAEFARHGIAGARIDRIAAEARANKQLIYAYYGNKGELFASVLEKKXLDL
1pb6A1          ---------------ILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIW
2g7gA1          -----------DRERIAEAALELVDRDG--DFRXPDLARHLNVQVSSIYHHAKGRAAVVELVRHRDGSAF
2id3A1          ---------ARIREAVLLAAGDALAADGFDALDLGEIARRAGVGKTTVYRRWGTPGGLAADLLADXAEQS
2gfnA1          ----------ERRRALADAVLALIAREGISAVTTRAVAEESGWSTGVLNHYFGSRHELLLAALRRAGDIQ


                         .         .         *         .         .         .         .:140
query           ERRLKMPEDHKATLGExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c07A1          RAAVR-----------------------------------------------------------------
2g7sA1          EAGI------------------------------------------------------------------
1z77A1          QKEFE-----------------------------------------------------------------
2hkuA1          GKRA------------------------------------------------------------------
2oi8A1          ADSL------------------------------------------------------------------
2g3bA1          RAYR------------------------------------------------------------------
2genA1          AALL------------------------------------------------------------------
2g7lA1          D---------------------------------------------------------------------
2hyjA1          WHRV------------------------------------------------------------------
1sgmA1          VEHL------------------------------------------------------------------
2fq4A1          LPVP------------------------------------------------------------------
1a6iA1          HDY-------------------------------------------------------------------
1v7bA1          DKEL------------------------------------------------------------------
2fbqA1          CASLEKELDRRQAKPE------------------------------------------------------
1ui5A1          RRLAK-----------------------------------------------------------------
2i10A1          TLQLE-----------------------------------------------------------------
1rktA1          LRKL------------------------------------------------------------------
1t56A1          DMALQ-----------------------------------------------------------------
1vi0A1          IER-------------------------------------------------------------------
2np5A1          LARL------------------------------------------------------------------
1zk8A1          HNRL------------------------------------------------------------------
2fd5A1          ----------------------------------------------------------------------
2iu5A1          INDN------------------------------------------------------------------
2np3B1          EAIT------------------------------------------------------------------
1jt0A1          ----------------------------------------------------------------------
1t33A1          GEKFR-----------------------------------------------------------------
2o7tA1          NV--------------------------------------------------------------------
2d6yA1          AISV------------------------------------------------------------------
1pb6A1          LAPL------------------------------------------------------------------
2g7gA1          ER--------------------------------------------------------------------
2id3A1          LPR-------------------------------------------------------------------
2gfnA1          GDRYR-----------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3c07A1          ----------------------------------------------------------------------
2g7sA1          ----------------------------------------------------------------------
1z77A1          ----------------------------------------------------------------------
2hkuA1          ----------------------------------------------------------------------
2oi8A1          ----------------------------------------------------------------------
2g3bA1          ----------------------------------------------------------------------
2genA1          ----------------------------------------------------------------------
2g7lA1          ----------------------------------------------------------------------
2hyjA1          ----------------------------------------------------------------------
1sgmA1          ----------------------------------------------------------------------
2fq4A1          ----------------------------------------------------------------------
1a6iA1          ----------------------------------------------------------------------
1v7bA1          ----------------------------------------------------------------------
2fbqA1          ----------------------------------------------------------------------
1ui5A1          ----------------------------------------------------------------------
2i10A1          ----------------------------------------------------------------------
1rktA1          ----------------------------------------------------------------------
1t56A1          ----------------------------------------------------------------------
1vi0A1          ----------------------------------------------------------------------
2np5A1          ----------------------------------------------------------------------
1zk8A1          ----------------------------------------------------------------------
2fd5A1          ----------------------------------------------------------------------
2iu5A1          ----------------------------------------------------------------------
2np3B1          ----------------------------------------------------------------------
1jt0A1          ----------------------------------------------------------------------
1t33A1          ----------------------------------------------------------------------
2o7tA1          ----------------------------------------------------------------------
2d6yA1          ----------------------------------------------------------------------
1pb6A1          ----------------------------------------------------------------------
2g7gA1          ----------------------------------------------------------------------
2id3A1          ----------------------------------------------------------------------
2gfnA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
3c07A1          --------------------------
2g7sA1          --------------------------
1z77A1          --------------------------
2hkuA1          --------------------------
2oi8A1          --------------------------
2g3bA1          --------------------------
2genA1          --------------------------
2g7lA1          --------------------------
2hyjA1          --------------------------
1sgmA1          --------------------------
2fq4A1          --------------------------
1a6iA1          --------------------------
1v7bA1          --------------------------
2fbqA1          --------------------------
1ui5A1          --------------------------
2i10A1          --------------------------
1rktA1          --------------------------
1t56A1          --------------------------
1vi0A1          --------------------------
2np5A1          --------------------------
1zk8A1          --------------------------
2fd5A1          --------------------------
2iu5A1          --------------------------
2np3B1          --------------------------
1jt0A1          --------------------------
1t33A1          --------------------------
2o7tA1          --------------------------
2d6yA1          --------------------------
1pb6A1          --------------------------
2g7gA1          --------------------------
2id3A1          --------------------------
2gfnA1          --------------------------