[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF07796.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1iw7F2.bssp"
#ERROR : Can't open dsspfile "1yioA1.bssp"
#ERROR : Can't open dsspfile "1p4wA.bssp"
#ERROR : Can't open dsspfile "1ku3A.bssp"
#ERROR : Can't open dsspfile "1h0mA1.bssp"
#ERROR : Can't open dsspfile "1k78A1.bssp"
#ERROR : Can't open dsspfile "1tc3C.bssp"
#ERROR : Can't open dsspfile "1rp3A2.bssp"
#ERROR : Can't open dsspfile "1z77A2.bssp"
#ERROR : Can't open dsspfile "1or7A1.bssp"
#ERROR : Can't open dsspfile "1iw7F3.bssp"
#ERROR : Can't open dsspfile "1or7A2.bssp"
#ERROR : Can't open dsspfile "1fseA.bssp"
#ERROR : Can't open dsspfile "1h3lA.bssp"
#ERROR : Can't open dsspfile "2dk5A1.bssp"
#ERROR : Can't open dsspfile "1resA.bssp"

## Summary of PDB Search
:188
    3e-10  16%  1iw7F2 [a.4.13.2] RNA POLYMERASE SIGMA-70 SUBUNIT F:319 -- 423
    6e-08  21%  1yioA1 [a.4.6.2] RESPONSE REGULATORY PROTEIN A:131 -- 200
    2e-07  15%  1p4wA  [a.4.6.2] RCSB
    4e-07  19%  1ku3A  [a.4.13.2] SIGMA FACTOR SIGA
    2e-06  17%  1h0mA1 [a.4.6.2] TRANSCRIPTIONAL ACTIVATOR PROTEIN TRAR A:170 --
    3e-06  16%  1k78A1 [a.4.1.5] PAIRED BOX PROTEIN PAX5 A:19 -- 81
    3e-06  10%  1tc3C  [a.4.1.2] PROTEIN (TC3 TRANSPOSASE)
    6e-06  17%  1rp3A2 [a.4.13.2] RNA POLYMERASE SIGMA FACTOR SIGMA-28 (FLIA) A:164
    2e-05  13%  1z77A2 [a.121.1.1] TRANSCRIPTIONAL REGULATOR (TETR FAMILY) A:76 --
    2e-05  24%  1or7A1 [a.4.13.2] RNA POLYMERASE SIGMA-E FACTOR A:120 -- 187
    3e-05  17%  1iw7F3 [a.177.1.1] RNA POLYMERASE SIGMA-70 SUBUNIT F:74 -- 257
    8e-05  22%  1or7A2 [a.177.1.1] RNA POLYMERASE SIGMA-E FACTOR A:-1 -- 111
    1e-04  30%  1fseA  [a.4.6.2] GERE
    1e-04  25%  1h3lA  [a.177.1.1] RNA POLYMERASE SIGMA FACTOR
    4e-04   0%  2dk5A1 [a.4.5.85] DNA-DIRECTED RNA POLYMERASE III 39 KDA A:8 -- 85
    8e-04   8%  1resA  [a.4.1.2] GAMMA DELTA-RESOLVASE
:188

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxTDQELSDFLASVERRAFKQAVFAVRDDEAALDIVQDAMIKLAEKYGDKSAAELPPLFQRILQNTIHDW
1iw7F2          ----------------------------------------------------------------------
1yioA1          ----------------------------------------------------------------------
1p4wA           ----------------------------------------------------------------------
1ku3A           ----------------------------------------------------------------------
1h0mA1          ----------------------------------------------------------------------
1k78A1          ----------------------------------------------------------------------
1tc3C           ----------------------------------------------------------------------
1rp3A2          ----------------------------------------------------------------------
1z77A2          ----KRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFFFSGFEEVYLRTYQGKPELLKRDXNTL
1or7A1          ----------------------------------------------------------------------
1iw7F3          ----------------LVVSIAKKYTGRGLSFLDLIQEGNQGLVEKFEYKRRFKFSTYATWWIRQAINRA
1or7A2          --TDQVLVERVQKGDQKAFNLLVLVSRPSGDVPDVVQEAFIKAYRALDSRGDSAFYTWLYRIAVNTAKNY
1fseA           ----------------------------------------------------------------------
1h3lA           ----------------QMYSAALRMTRNPADAEDLVQETYAKAYASFHQREGTNLKAWLYRILTNTFINS
2dk5A1          ----------------------------------------------------------------------
1resA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FRRQKVRNTWVTLFSNLRDEREGDDSDLLDTLEAQAGTEMAESSADKVERAQVMHIIEQEIQRLPTRQRE
1iw7F2          ---------------------DEKDSFYGDFIPDEH----LPSPVDAATQSLLSEELEKALSKLSEREAM
1yioA1          ---------------------------------------------------ETQDQLEQLFSSLTGREQQ
1p4wA           ------------------------------------------TPESVAKLLEKISAGGYGDKRLSPKESE
1ku3A           --------------------------------------------------------LEKALSKLSEREAM
1h0mA1          -----------------------------------------------------------DAAWLDPKEAT
1k78A1          --------------------------------------------------------VFVNGRPLPDVVRQ
1tc3C           --------------------------------------------------------------ALSDTERA
1rp3A2          ------------------------------------------NVEEEVIKRELTEKVKEAVSKLPEREKL
1z77A2          VEEVKVXLRIL-----------------------------------------------------------
1or7A1          ---------------------------------------------NLMLSEELRQIVFRTIESLPEDLRM
1iw7F3          IADQA-----------------------------------------------------------------
1or7A2          LVAQGRRPPSSDVDAIEAENFESGGA--------------------------------------------
1fseA           ------------------------------------------------------------KPLLTKRERE
1h3lA           YR--------------------------------------------------------------------
2dk5A1          --------------------------------------------------------NAGKMKGSDNQEKL
1resA           --------------------------------------------------------------KRKIDRDA


                         +         .         .         .         .         *         .:210
query           AFLMRYWEDMDVAETAAVMGCSEGSVKTHCSRATHTLAQALRARGVRL
1iw7F2          -VLKLRKGLIDGEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLR
1yioA1          VLQLTI-RGLMNKQIAGELGIAEVTVKVHRHNIMQKLNVRSLANLVHL
1p4wA           -VLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVDNDIALLNY
1ku3A           VLKMRKGREHTLEEVGAYFGVTRERIRQIENKA---------------
1h0mA1          YLRWIA-VGKTXEEIADVEGVKYNSVRVKLREAXKRFDVRSKAHLTAL
1k78A1          RIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETG-----------
1tc3C           QLDVMKLLNVSLHEMSRKISRSRHCIRVYLKDP---------------
1rp3A2          VIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLREMLS------
1z77A2          ------------------------------------------------
1or7A1          AITLRELDGLSYEEIAAIMDCPVGTVRSRIFRAREAIDNKVQ------
1iw7F3          ------------------------------------------------
1or7A2          ------------------------------------------------
1fseA           VFELLV-QDKTTKEIASELFISEKTVRNHISNAMQKLGVKGRSQAVVE
1h3lA           ------------------------------------------------
2dk5A1          VYQIAGNKGIWSRDVRYKSNLPLTEINKILKN----------------
1resA           VLNM-WQQGLGASHISKTMNIARSTVYKVINE----------------