[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF07810.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ztpA1.bssp"
#ERROR : Can't open dsspfile "1iyzA1.bssp"
#ERROR : Can't open dsspfile "1o89A2.bssp"
#ERROR : Can't open dsspfile "1iyzA2.bssp"
#ERROR : Can't open dsspfile "1v3tA2.bssp"
#ERROR : Can't open dsspfile "1yb5A2.bssp"
#ERROR : Can't open dsspfile "1a71A2.bssp"
#ERROR : Can't open dsspfile "1pqwA.bssp"
#ERROR : Can't open dsspfile "1qorA1.bssp"
#ERROR : Can't open dsspfile "1kolA1.bssp"
#ERROR : Can't open dsspfile "1e3jA2.bssp"
#ERROR : Can't open dsspfile "1h2bA2.bssp"
#ERROR : Can't open dsspfile "1y88A2.bssp"
#ERROR : Can't open dsspfile "1v3tA1.bssp"
#ERROR : Can't open dsspfile "1vj1A1.bssp"
#ERROR : Can't open dsspfile "1lluA2.bssp"
#ERROR : Can't open dsspfile "1vj0A2.bssp"
#ERROR : Can't open dsspfile "1gu7A1.bssp"
#ERROR : Can't open dsspfile "1o89A1.bssp"
#ERROR : Can't open dsspfile "1a71A1.bssp"
#ERROR : Can't open dsspfile "1bxzA2.bssp"
#ERROR : Can't open dsspfile "1wkvA1.bssp"
#ERROR : Can't open dsspfile "1gv8A.bssp"
#ERROR : Can't open dsspfile "1e3jA1.bssp"
#ERROR : Can't open dsspfile "1kolA2.bssp"
#ERROR : Can't open dsspfile "1o8cA2.bssp"
#ERROR : Can't open dsspfile "1zjcA1.bssp"
#ERROR : Can't open dsspfile "1piwA2.bssp"
#ERROR : Can't open dsspfile "1f8fA1.bssp"
#ERROR : Can't open dsspfile "1uufA1.bssp"
#ERROR : Can't open dsspfile "1vj0A1.bssp"
#ERROR : Can't open dsspfile "1bxzA1.bssp"
#ERROR : Can't open dsspfile "1a9xA3.bssp"
#ERROR : Can't open dsspfile "1qorA2.bssp"
#ERROR : Can't open dsspfile "1cjcA1.bssp"
#ERROR : Can't open dsspfile "2ck3H2.bssp"
#ERROR : Can't open dsspfile "1escA.bssp"
#ERROR : Can't open dsspfile "1e0tA3.bssp"
#ERROR : Can't open dsspfile "1edzA1.bssp"
#ERROR : Can't open dsspfile "1gu7A2.bssp"
#ERROR : Can't open dsspfile "1c3vA1.bssp"
#ERROR : Can't open dsspfile "1vm6A3.bssp"
#ERROR : Can't open dsspfile "2bgkA1.bssp"

## Summary of PDB Search
:334
    4e-34  12%  1ztpA1 [d.86.1.2] BASOPHILIC LEUKEMIA EXPRESSED PROTEIN BLES03 A:17
    2e-32  38%  1iyzA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:1 -- 98 A:270 -- 302
    4e-31  21%  1o89A2 [c.2.1.1] YHDH A:116 -- 292
    2e-28  27%  1iyzA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:99 -- 269
    3e-27  26%  1v3tA2 [c.2.1.1] LEUKOTRIENE B4 12- A:113 -- 294
    5e-27  29%  1yb5A2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:121 -- 294
    1e-25  15%  1a71A2 [c.2.1.1] LIVER ALCOHOL DEHYDROGENASE A:164 -- 339
    2e-24  30%  1pqwA  [c.2.1.1] POLYKETIDE SYNTHASE
    6e-23  29%  1qorA1 [b.35.1.2] QUINONE OXIDOREDUCTASE A:2 -- 112 A:292 -- 327
    1e-22  17%  1kolA1 [b.35.1.2] FORMALDEHYDE DEHYDROGENASE A:2 -- 160 A:356 --
    1e-22  22%  1e3jA2 [c.2.1.1] NADP(H)-DEPENDENT KETOSE REDUCTASE A:143 -- 312
    5e-22  24%  1h2bA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:155 -- 326
    7e-22  14%  1y88A2 [c.52.1.30] HYPOTHETICAL PROTEIN AF1548 A:3 -- 127
    2e-21  12%  1v3tA1 [b.35.1.2] LEUKOTRIENE B4 12- A:1 -- 112 A:295 -- 329
    3e-21  12%  1vj1A1 [b.35.1.2] PUTATIVE NADPH-DEPENDENT OXIDOREDUCTASE A:-1 --
    6e-21  24%  1lluA2 [c.2.1.1] ALCOHOL DEHYDROGENASE A:144 -- 309
    6e-21  20%  1vj0A2 [c.2.1.1] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:156 --
    2e-20  19%  1gu7A1 [b.35.1.2] 2,4-DIENOYL-COA REDUCTASE A:23 -- 160 A:350 --
    3e-20  20%  1o89A1 [b.35.1.2] YHDH A:1 -- 115 A:293 -- 323
    6e-20  25%  1a71A1 [b.35.1.2] LIVER ALCOHOL DEHYDROGENASE A:1 -- 163 A:340 --
    1e-19  24%  1bxzA2 [c.2.1.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:140 -- 313
    2e-19  10%  1wkvA1 [c.79.1.1] CYSTEINE SYNTHASE A:2 -- 383
    8e-19   5%  1gv8A  [c.94.1.2] OVOTRANSFERRIN
    1e-16  20%  1e3jA1 [b.35.1.2] NADP(H)-DEPENDENT KETOSE REDUCTASE A:4 -- 142
    2e-16  16%  1kolA2 [c.2.1.1] FORMALDEHYDE DEHYDROGENASE A:161 -- 355
    1e-15  27%  1o8cA2 [c.2.1.1] YHDH A:116 -- 192
    1e-15   7%  1zjcA1 [e.60.1.1] AMINOPEPTIDASE AMPS A:3 -- 415
    1e-14  24%  1piwA2 [c.2.1.1] HYPOTHETICAL ZINC-TYPE ALCOHOL DEHYDROGENASE-
    2e-14  24%  1f8fA1 [b.35.1.2] BENZYL ALCOHOL DEHYDROGENASE A:4 -- 162 A:337 --
    4e-14  23%  1uufA1 [b.35.1.2] ZINC-TYPE ALCOHOL DEHYDROGENASE-LIKE PROTEIN A:3
    7e-14  18%  1vj0A1 [b.35.1.2] ALCOHOL DEHYDROGENASE, ZINC-CONTAINING A:2 -- 155
    8e-13  19%  1bxzA1 [b.35.1.2] NADP-DEPENDENT ALCOHOL DEHYDROGENASE A:1 -- 139
    2e-12  14%  1a9xA3 [c.30.1.1] CARBAMOYL PHOSPHATE SYNTHETASE (LARGE CHAIN) A:1
    2e-10  29%  1qorA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:113 -- 291
    8e-10  13%  1cjcA1 [c.3.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:107 -- 331
    1e-09  13%  2ck3H2 [b.93.1.1] ATP SYNTHASE DELTA CHAIN H:17 -- 101
    1e-09   6%  1escA  [c.23.10.1] ESTERASE
    2e-09  10%  1e0tA3 [c.49.1.1] PYRUVATE KINASE A:354 -- 470
    3e-08  12%  1edzA1 [c.2.1.7] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE A:149
    3e-06  13%  1gu7A2 [c.2.1.1] 2,4-DIENOYL-COA REDUCTASE A:161 -- 349
    4e-04  12%  1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:715
    7e-04  11%  1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 --
    8e-04  36%  2bgkA1 [c.2.1.2] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE A:11 --
:334

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKAIEIREYGAPEVLQETQRPDPEPKAGEILIRVAAAGINRPDVFQRTGNYPVPPGASDLPGLEVAGVVV
1ztpA1          -----------------------------------------PWLVFDARTTPATELDAWLAKYPPSQVTR
1iyzA1          MKAWVLKRLGGPLELVD--LPEPEAEEGEVVLRVEAVGLNFADHLMRLGAYLTRLHPPFIPGMEVVGVV-
1o89A2          ----------------------------------------------------------------------
1iyzA2          ----------------------------------------------------------------------
1v3tA2          ----------------------------------------------------------------------
1yb5A2          ----------------------------------------------------------------------
1a71A2          ----------------------------------------------------------------------
1pqwA           ----------------------------------------------------------------------
1qorA1          -TRIEFHKHGGPEVLQAVEFTPADPAENEIQVENKAIGINFIDTYIRSGLYP-PPSLPSGLGTEAAGIVS
1kolA1          NRGVVYLGSGKVEVYPKMQDPRGKKIEHGVILKVVSTNICGSDQHMVRGRTTAQVGLV--LGHEITGEVI
1e3jA2          ----------------------------------------------------------------------
1h2bA2          ----------------------------------------------------------------------
1y88A2          ----------------------------------------------------------------------
1v3tA1          AKSWTLKKHPTQSDFELKTVELPPLKNGEVLLEALFLSVDPYMRIASKRLKEGAV----MMGQQVARV--
1vj1A1          VLNSRPGKNGNPENFRVEEFSLLDANEGQVQVRTLYLSVDPYXRCKXNEDTGTDYLAPWQLAQVADGGGI
1lluA2          ----------------------------------------------------------------------
1vj0A2          ----------------------------------------------------------------------
1gu7A1          AQAVLYTQHGEPKFTQSFEIDDDNLAPNEVIVKTLGSPVNPSDINQIQGVYPSKPAKTTGFGTTEPAAPC
1o89A1          -----------------QTLDESRLPEGDVTVDVHWSSLNYKDALAITGKGKIIRNFPMIPGIDFAGTVR
1a71A1          CKAAVLWEEKKPFSIEE--VEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPL--PVIAGHEAAGIVE
1bxzA2          ----------------------------------------------------------------------
1wkvA1          ---------------------------GFSYLENAREVLRSGEARRSEPEYVKALYVIGGDGCSHTLEEL
1gv8A           ------------------AVAVVKKGTDFMIKDLRGKTSCHTGLGRSAGWNIPI------GTLIHRGDIE
1e3jA1          LSAV----LYKQNDLRLEQRPIPEPKEDEVLLQMAYVGICGSDVHYYEHGRIADFIVK--DPMVIGHEAS
1kolA2          ----------------------------------------------------------------------
1o8cA2          ----------------------------------------------------------------------
1zjcA1          ----------------------------------------------------------------------
1piwA2          ----------------------------------------------------------------------
1f8fA1          IIAAVTPCKGADFELQA--LKIRQPQGDEVLVKVVATGMCHTDLIVRDQKYPVPLPA--VLGHEGSGIIE
1uufA1          IKAVGA--YSAKQPLEPMDITRREPGPNDVKIEIAYCGVCHSDLHQVRSEWAGTVYPC-VPGHEIVGRVV
1vj0A1          AHAMVLEKFNQPLVYKE--FEISDIPRGSILVEILSAGVCGSDVHMFRGEDPRVP-LPIILGHEGAGRVV
1bxzA1          MKGFAMLS---IGKVGWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAI-GERHNMILGHEAVGEVV
1a9xA3          ----------------------------------------------------------------------
1qorA2          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
2ck3H2          --------FASPTQVFFNQVDVPTLRPGLVVVFVSSGSQLLAEEAVT-----------------------
1escA           ----------------------------------------------------------------------
1e0tA3          APLIVVATQGGKSA-----RAVRKYFPDATILALTTNEKTAHQLVLSKGVVPQLVKEIT-STDDFYRLGK
1edzA1          ----------------------------------------------------------------------
1gu7A2          ----------------------------------------------------------------------
1c3vA1          ----------------------------------------------------------------------
1vm6A3          ----------------------------------------------------------------------
2bgkA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GGDLSHPANRFGLKAGDRVCALVQGGGYAELCTAPIEQCLPVPEGLTDIEAAALPETFFTVWSNVFDRGQ
1ztpA1          YG-----------DPGSPNSEP---VGWIAVYGQGYSPNSGDVQGLQAAWEALQTSGRPITPGTLRQLAI
1iyzA1          --------------EGRRYAALVPQGGLAERVAVPKGALLPLPEGR-PVVGPVFPAEAEAAFRALLDRGH
1o89A2          ---------------------------------------------LDARKAMIIGTAGFTAMLCVMALED
1iyzA2          ---------------------------------------------LSPEEAAAFPVSFLTAYLALKR---
1v3tA2          -----------------------------------------LPLSL---ALGTIGMPGLTAYFGLLEVCG
1yb5A2          ---------------------------------------------LDFKQGAAIGIPYFTAYRALIHSAC
1a71A2          -------------------------------------------------KVCLIGCGFSTGYGSAVKVAK
1pqwA           -------------------------------------------------EAATFGVAYLTAWHSLCEVGR
1qorA1          ----KVGSGVKHIKAGDRVVYAQSAGAYSSVHNIIADKAAILPAAIKVDVAEQQKYPLKDAQRHEILESR
1kolA1          EKGRDVE----NLQIGDLVSVPFNVAAEYVLVPYADFNLLKLPDRDKAMEKINIAEVVGVQVISLDD---
1e3jA2          -----------------------------------------------SLEEGALLEPLSVGVHAC-RRAG
1h2bA2          -----------------------------------------ISREKLV-EMAPLADAGITAYRAVKKAAR
1y88A2          ------------------------------------------LYFQGHMVARLLEEHGFETKTNVIVQGN
1v3tA1          -----VESKNSAFPAGSIVLAQSGWTTHFISDGKGLEKLLTEWPDKKIQYHEHVTKGFENMPAAFIEMLN
1vj1A1          GIVEESKHQKL--AKGDFVT--SFYWPWQTKAILDGNGLEKVDPQLVDGLKV---------------KET
1lluA2          ---------------------------------------------VEFAEIAPILCAGVTVYKGLK-QTN
1vj0A2          -------------------------------------------------VLAMAMCSGATAYHAFDEYPE
1gu7A1          GNEGLVGSNVSSLEAGDWVPSHVNFGTWRTHALGNDDDFIKLPNPAQSKANGKPGLTDAKSIETLYDGTK
1o89A1          T------SEDPRFHAGQEVLLTGWGGGLAEQARVKGDWLVAMPQGQAAKEISLSEAPNFAEAIINNQI--
1a71A1          ----SIGEGVTTVRPGDKVPLWTPQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDGTSRFTCR--------
1bxzA2          -----------------------------------------------PLEAAVMIPDMMTTGFHGAELAD
1wkvA1          GVFDISVPGEMVFPSPLDFFERG-KPTPLVRSRLQLPNGVRVWLKLEWYNPFSLSVKDRPAVEIISRLSR
1gv8A           WE----GIESGSVEQAVAKFFSASCVPGATTEQKLCRQCKGDAKTKCLRNAPYSGYSGAFQCLKDGKGDV
1e3jA1          GTVVKVGKNVKHLKKGDRVAVEPGVPNLARYYVHAADFCHKLPDNCNVKQLVTHSFKLEQTV-DAFEAAR
1kolA2          -------------------------------------------------DLTCLSDILPTGYHGA-VTAG
1o8cA2          ---------------------------------------------LDARKAMIIGTAGFTAMLCVMALED
1zjcA1          ----------------------------------------------------------------VKVGMN
1piwA2          ----------------------------------------------------------------------
1f8fA1          ----AIGPNVTELQVGDHVVLSYGYCGKCTQCNTGNPAYCSEFFGRNFSGADSEGNHALCVNDHFFAQS-
1uufA1          ----AVGDQVEKYAPGDLVCDHMTGGGYSQQIVVHERYVLRIRVADIEMIRADQINE-------------
1vj0A1          NGEKRDPNRKVYGINRGCSEYPHLRGCYSSHIVLDPETDVLKVSEKITHRLP------LKEANKALELME
1bxzA1          GSEVKD------FKPGDRVVVNVKDGVFGEFFHVNDMNLAHLPKEVDPSKLVTHVFRGFDNIEKAF----
1a9xA3          ----------------------------------------------------------------------
1qorA2          ---------------------------------------------ISFEQAAASFLKGLTVYYLLRKTYE
1cjcA1          ---------------------------------------LDIPEELPGVFSARAFVGWYNGLPENRELAP
2ck3H2          ----------------------------------------------------------------------
1escA           ---------------GALIHHFWEKQELPFGAGELPPQQDALKQDTQL--TVGSLGGNTLGFNRILKQCS
1e0tA3          ----ELALQSGLAHKGDVVVMVLVPSGTTNTA--------------------------------------
1edzA1          -------------------------------------------------LAIVKILEFLKIYNNLLPEGN
1gu7A2          ---------------------------------------------LTINQGATISVNPLTAYLMLTHYVK
1c3vA1          ----------------------------------------------------------------------
1vm6A3          ----------------------------------------------------------------------
2bgkA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LGKGPRGAAETLLIQGGSSGIGTTAIQIAKALGFKVFVTAGSDDKCKACESLGADRAINYKTQDFVAEVK
1ztpA1          THHVLSG--KWLXHLAPGFKLDHAWAGIARAVVEGRLQVAKVSPRAKEGRQVICVYTDDFTDRLGVLEAD
1iyzA1          TGK-------------------------------------------------------------------
1o89A2          AGVRPQD--GEIVVTGASGGVGSTAVALLHKLGYQVVAVSGRESTHEYLKSLGASRVLPRDEFAESRP--
1iyzA2          ---AQARPGEKVLVQAAAGALGTAAVQVARAMGLRVLAAASRPEKLALPLALGAEEAATYAE-----VPE
1v3tA2          VKGG-----ETVLVSAAAGAVGSVVGQIAKLKGCKVVGAAGSDEKIAYLKQIGFDAAFNYKTVNSLEEAL
1yb5A2          VKAG-----ESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIK
1a71A2          VTQG-----STCAVFGLGGAGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQYKKPIQEVL
1pqwA           LSPG-----ERVLIHSATGGVGMAAVSIAKMIGARIYTTAGSDAKREMLSRLGVEYVGDSRSVDFADEIL
1qorA1          ATQG-----SSLLI--------------------------------------------------------
1kolA1          --------APRGYGEFDAGVPKKFVIDPHKTFS-------------------------------------
1e3jA2          VQLGTT------VLVIGAGPIGLVSVLAAKAYGAFVVCTARSPRRLEVAKNCGADVTLVVDPAKSIIERI
1h2bA2          TLYP-----GAYVAIVGVGGLGHIAVQLLKVMTPAVIALDVKEEKLKLAERLGADHVVDARR-DPVKQVM
1y88A2          CVEQEID----VVAERDGERYMIECKFHNIPVYTGLKEAMYTYARFLDVEKHGFTQPWIFTNTKFSEEAK
1v3tA1          GANL-----GKAVVT-------------------------------------------------------
1vj1A1          VAKGLENXGVAFQSXXTGGNVGKQIVCISEDSS-------------------------------------
1lluA2          ARPGQW------VAISGIGGLGHVAVQYARAMGLHVAAIDIDDAKLELARKLGASLTVNARQEDPVEAIQ
1vj0A2          SFAGKT------VVIQGAGPLGLFGVVIARSLGAENVIIAGSPNRLKLAEEIGADLTLNRREEERRKAIM
1gu7A1          PLH------ELYQDGVANSKDGKQLIT-------------------------------------------
1o89A1          -------QGRTLVK--------------------------------------------------------
1a71A1          ----------------------------------------------------------------------
1bxzA2          IELG-----ATVAVLGIG-PVGLMAVAGAKLRGAGIIAVGSRPVCVDAAKYYGATDIVNYKDGPIESQIM
1wkvA1          RVEK-----GSLVADATSSNFGVALSAVARLYGYRARVYLPEEFGKLLPRLLGAQVIVDPEAPSTLPRVM
1gv8A           AFVKHTT-----VQENAPEEKDEYELLCLDGTR--QPVDSYK----------------------------
1e3jA1          KKAD-----NTIKVMISCR---------------------------------------------------
1kolA2          VGPG-----STVYV-AGAGPVGLAAAASARLLGAAVIVGDLNPARLAHAKAQGFEIADLSLDTPLHEQIA
1o8cA2          AGVRPQD--GEIVVTGASGGVGSTAVALLHKLGYQVVAVSGRESTHEYLKSLGA----------------
1zjcA1          VQPK-----QPVFISVETLELTHLIVEEAYHCGASDVRVVYSDPTLKRLKFENESVEHFANHESYDVEAR
1piwA2          ----------------GLGGIGSMGTLISKAMGAETYVISRSSRKREDAMKMGADHYIATLEEGDWGEKY
1f8fA1          ----------------------------------------------------------------------
1uufA1          ----------------------------------------------------------------------
1vj0A1          SREA-----LKVIL--------------------------------------------------------
1bxzA1          ----------------------------------------------------------------------
1a9xA3          ---------KSILILG-AGPIVIGQACEFDYSGAQACKALREEGRVINVNSNPATIMTDPEMAIHWEVVR
1qorA2          -----IKPDEQFLFHAAAGGVGLIACQWAKALGAKLIGTVGTAQKAQSALKAGAWQVINYREEDLVERLK
1cjcA1          DLSCDT------AVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLKELR
2ck3H2          ----------------------------------------------------------------------
1escA           DELRKP------SLLPGDPVDGDEPAAKCGEFFGTGDGKQWLDDQFERV------GAELEELLDRIGYFA
1e0tA3          ----------------------------------------------------------------------
1edzA1          RLYG-----KKCIVINRSEIVGRPLAALLANDGATVYSVDVNNIQKFTRGESLKLNKHHVEDLGEYSEDL
1gu7A2          LTPGKD---WFIQNGGTSAVGKYASQIGKLLNFNSISVIRDRPNLDEVVASLKELGATQVITEDQNNKEW
1c3vA1          ------------GVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGN
1vm6A3          ------------GIVGYSGRMGQEIQKVFSEKGHELVLKVDVNGVEELDSPDVVIDFSSP---EALPKTV
2bgkA1          ----------VAIITGGAGGIGTTAKLFVRY-GAKVVIADIADDHGQKVC--------------------


                         .         .         .         +         .         .         .:280
query           ALTEGKGVDVILDMVAGSYLARELSCIADDGRIVIIALLGGGKAEIPLGDILRRRITITGSTLRPRPASF
1ztpA1          SAIRAAGIKCLLTYKPDVYTYLGIYRANRWHLCPTL-----YESRFQGSRVLDRANNVE-----------
1iyzA1          ----------------------------------------------------------------------
1o89A2          --LEKQVWAGAIDTVGDKVLAKVLAQMNYGGCVAACGLAGGFTLPTTVMPFILRNVRLQGVDSVMTPPER
1iyzA2          RAKAWGGLDLVLEVR-GKEVEESLGLLAHGGRLVYIGAAEA---PIPPLRLMRRNLAVLGFWLTPLL---
1v3tA2          KKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYPPGPSPESIIYKQLRIEGFIVY----RW
1yb5A2          KYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGT--IEINPRDTMAKESSIIGVTLFSSTKEE
1a71A2          TEMSNGGVDFSFEVIGRLDTMVTSCCQEAYGVSVIVGVPPDSQNLSMNPMLLLSGRTWKGAIFGGFK--S
1pqwA           ELTDGYGVDVVLNSLAGEAIQRGVQILAPGGRFIELGKKDVY-ADASLGAALAKSASFSVVDLDLNLKLQ
1qorA1          ----------------------------------------------------------------------
1kolA1          ----------------------------------------------------------------------
1e3jA2          RSAIGDLPNVTIDCSGNEKCITIGINITRTGGTLMLVGMGSQMVTVPLVNACAREIDIKSVFRYCN----
1h2bA2          ELTRGRGVNVAMDVGSQATVDYTPYLLGRMGRLIIVGY--GGELRFPTIRVISSEVSFEGSLVGNYV---
1y88A2          KYAGCVGIKLTGW----SYPEKEG----------------------------------------------
1v3tA1          ----------------------------------------------------------------------
1vj1A1          ----------------------------------------------------------------------
1lluA2          RDI-GGAHGVLVTAVSNSAFGQAIGMARRGGTIALVG-LPPGDFPTPIFDVVLKGLHIAGSIVGTRA---
1vj0A2          DITHGRGADFILEATGDSRALLEGSELLRRGGFYSVAGVAVPQDPVPFEWLVLKNATFKGIWVSDT-SHF
1gu7A1          ----------------------------------------------------------------------
1o89A1          ----------------------------------------------------------------------
1a71A1          ----------------------------------------------------------------------
1bxzA2          NLTEGKGVDAIIAGGNADIMATAVKIVKPGGTIANVNYFGEG-EVLPVPGCGMAHKTIKGG---------
1wkvA1          KDSKNEGFVHVNQFY-------------------------------------------------------
1gv8A           ----------------------------------------------------------------------
1e3jA1          ----------------------------------------------------------------------
1kolA2          ALLGEPEVDCAVDAVGFEARGHGHEGAKHEGKIGIPGLYVTEDPGAVDAAAKIGSLSIRFGLGWAKSHSF
1o8cA2          ----------------------------------------------------------------------
1zjcA1          MDYVKRGAANLALISEDPDLMDGIDSQKLQAFQQ----QNARAFKGYMESVQKNQFPWVVAAFPSKAWAK
1piwA2          F----DTFDLIVVCASSLTFNIMPKAMKVGGRIVSISIPEQHE-MLSLKPYGLKAVSISYS---------
1f8fA1          ----------------------------------------------------------------------
1uufA1          ----------------------------------------------------------------------
1vj0A1          ----------------------------------------------------------------------
1bxzA1          ----------------------------------------------------------------------
1a9xA3          KIIEKERPDAVLPTMGGQTALNCALELERQGVLEEFGVTMIG----------------------------
1qorA2          EITGGKKVRVVYDSVGRDTWERSLDCLQRRGLMVSFGNSSGAVTGVNLGILNQKGSLY------------
1cjcA1          EMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTATEKPGVEEAARR----------------
2ck3H2          ----------------------------------------------------------------------
1escA           PDAKRVLVGYPRLVPEDTTKCLTPGQTQLPFADIPQDALPVLD---------------------------
1e0tA3          ----------------------------------------------------------------------
1edzA1          LKKCSLDSDVVITGVPSENYKFPTEYIKEGAVCINFACTK------------------------------
1gu7A2          IKQSGGEAKLALNCVGGKSSTGIARKLNNNGLMLTYGGMSVTIPTSLYFKNFTSAGFWVTELLKNNKELK
1c3vA1          LEFLIDNGIHAVVGTTG-----------------------------------------------------
1vm6A3          DLCKKYRAGLVLGTTA------------------------------------------------------
2bgkA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           KGAIAQALHQNVWPLLASGKIKPVIHKVFPxxxxxxxxxxxxxxxxxxxxxxxx
1ztpA1          ------------------------------------------------------
1iyzA1          ------------------------------------------------------
1o89A2          RAQAWQRLVADLPE----------------------------------------
1iyzA2          --REGALVE------EALGFLLPRLGREL-------------------------
1v3tA2          QGDVREKALRDLMKWVLEG-----------------------------------
1yb5A2          FQQYAAALQA----GMEIG-----------------------------------
1a71A2          KDSVPKLV-----ADFMAKK----------------------------------
1pqwA           PARYRQLLQH-ILQHVADGKLEVL------------------------------
1qorA1          ------------------------------------------------------
1kolA1          ------------------------------------------------------
1e3jA2          --DYPIALE-----MVASGR----------------------------------
1h2bA2          ------------------------------------------------------
1y88A2          ------------------------------------------------------
1v3tA1          ------------------------------------------------------
1vj1A1          ------------------------------------------------------
1lluA2          ------------------------------------------------------
1vj0A2          VKTVS---------ITSRNYQLL-------------------------------
1gu7A1          ------------------------------------------------------
1o89A1          ------------------------------------------------------
1a71A1          ------------------------------------------------------
1bxzA2          ------------------------------------------------------
1wkvA1          ------------------------------------------------------
1gv8A           ------------------------------------------------------
1e3jA1          ------------------------------------------------------
1kolA2          HTGQTMKYNRALMQAIMWDR----------------------------------
1o8cA2          ------------------------------------------------------
1zjcA1          RVYPELSVEEAYIKFIDEVFDIVRIDGNDP------------------------
1piwA2          ------------------------------------------------------
1f8fA1          ------------------------------------------------------
1uufA1          ------------------------------------------------------
1vj0A1          ------------------------------------------------------
1bxzA1          ------------------------------------------------------
1a9xA3          ------------------------------------------------------
1qorA2          ------------------------------------------------------
1cjcA1          ------------------------------------------------------
2ck3H2          ------------------------------------------------------
1escA           ------------------------------------------------------
1e0tA3          ------------------------------------------------------
1edzA1          ------------------------------------------------------
1gu7A2          LNQ--------IIAWYEEGK----------------------------------
1c3vA1          ------------------------------------------------------
1vm6A3          ------------------------------------------------------
2bgkA1          ------------------------------------------------------