[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF07859.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dciA.bssp"
#ERROR : Can't open dsspfile "1uiyA.bssp"
#ERROR : Can't open dsspfile "1wdkA4.bssp"
#ERROR : Can't open dsspfile "1hzdA.bssp"
#ERROR : Can't open dsspfile "1dubA.bssp"
#ERROR : Can't open dsspfile "1jxzA.bssp"
#ERROR : Can't open dsspfile "1ef8A.bssp"
#ERROR : Can't open dsspfile "1q51A.bssp"
#ERROR : Can't open dsspfile "1wz8A1.bssp"
#ERROR : Can't open dsspfile "1hnoA.bssp"
#ERROR : Can't open dsspfile "2f6qA1.bssp"
#ERROR : Can't open dsspfile "2a7kA1.bssp"
#ERROR : Can't open dsspfile "1sg4A1.bssp"
#ERROR : Can't open dsspfile "1o8uA.bssp"
#ERROR : Can't open dsspfile "1pixA2.bssp"
#ERROR : Can't open dsspfile "1od2A2.bssp"
#ERROR : Can't open dsspfile "1pixA3.bssp"
#ERROR : Can't open dsspfile "1cjdA2.bssp"
#ERROR : Can't open dsspfile "1dfcA3.bssp"
#ERROR : Can't open dsspfile "2f9yA1.bssp"
#ERROR : Can't open dsspfile "1tg6A1.bssp"
#ERROR : Can't open dsspfile "1u5tB1.bssp"
#ERROR : Can't open dsspfile "2f9yB1.bssp"

## Summary of PDB Search
:259
    7e-52  25%  1dciA  [c.14.1.3] DIENOYL-COA ISOMERASE
    6e-51  30%  1uiyA  [c.14.1.3] ENOYL-COA HYDRATASE
    5e-49  20%  1wdkA4 [c.14.1.3] FATTY OXIDATION COMPLEX ALPHA SUBUNIT A:1 -- 310
    8e-49  28%  1hzdA  [c.14.1.3] AU-BINDING PROTEIN/ENOYL-COA HYDRATASE
    3e-48  28%  1dubA  [c.14.1.3] 2-ENOYL-COA HYDRATASE
    2e-47  26%  1jxzA  [c.14.1.3] 4-CHLOROBENZOYL COENZYME A DEHALOGENASE
    1e-45  26%  1ef8A  [c.14.1.3] METHYLMALONYL COA DECARBOXYLASE
    1e-45  26%  1q51A  [c.14.1.3] MENB
    2e-44  23%  1wz8A1 [c.14.1.3] ENOYL-COA HYDRATASE A:2 -- 264
    9e-42  18%  1hnoA  [c.14.1.3] D3,D2-ENOYL COA ISOMERASE ECI1
    1e-41  25%  2f6qA1 [c.14.1.3] PEROXISOMAL 3,2-TRANS-ENOYL-COA ISOMERASE A:108
    3e-39  26%  2a7kA1 [c.14.1.3] CARB A:1 -- 230
    5e-39  21%  1sg4A1 [c.14.1.3] 3,2-TRANS-ENOYL-COA ISOMERASE, MITOCHONDRIAL A:2
    7e-35  19%  1o8uA  [c.14.1.3] 6-OXO CAMPHOR HYDROLASE
    2e-29  14%  1pixA2 [c.14.1.4] GLUTACONYL-COA DECARBOXYLASE A SUBUNIT A:1 --
    2e-29  10%  1od2A2 [c.14.1.4] ACETYL-COENZYME A CARBOXYLASE A:1815 -- 2203
    3e-19  10%  1pixA3 [c.14.1.4] GLUTACONYL-COA DECARBOXYLASE A SUBUNIT A:288 --
    3e-19  10%  1cjdA2 [b.121.2.1] PROTEIN (MAJOR CAPSID PROTEIN (P3)) A:245 -- 383
    3e-17   9%  1dfcA3 [b.42.5.1] FASCIN A:1260 -- 1382
    1e-16   8%  2f9yA1 [c.14.1.4] ACETYL-COA CARBOXYLASE, CARBOXYLTRANSFERASE A:4
    9e-16   9%  1tg6A1 [c.14.1.1] PUTATIVE ATP-DEPENDENT CLP PROTEASE PROTEOLYTIC
    2e-10  15%  1u5tB1 [a.4.5.54] DEFECTIVE IN VACUOLAR PROTEIN SORTING VPS36P
    2e-05  21%  2f9yB1 [c.14.1.4] ACETYL-COENZYME A CARBOXYLASE CARBOXYL B:23 --
:259

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTAQLLSERVDSTLVLTISNPEARNALHPDIYXXXXXXXXXXXRDDSIRAVILTGADGVFCAGGNLNRLL
1dciA           ----QVTSAQKHVLHVQLNRPEKRNAMNRAFWRELVECFQKISKDSDCRAVVVSGAGKMFTSGIDLMDMA
1uiyA           --------------VVFLNDPERRNPLSPEXALSLLQALDDLEADPGVRAVVLTGRGKAFSAGADLAFLE
1wdkA4          MIYETVTALESGIVELKFDLGESVNKFNRLTLNELRQAVDAIKADASVKGVIVSSGKDVFIVGADITEFV
1hzdA           LRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKER
1dubA           -------GKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAFAAGADIKEM-
1jxzA           ----IGHRVEDGVAEITIKLPRHRNALSVKAMQEVTDALNRAEEDDSVGAVMITGAEDAFCAGFYLREIP
1ef8A           MSYQVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSVFSAGHDIHELD
1q51A           ----YHRHVDDATVRVAFNRPEVRNAFRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSG
1wz8A1          ----LAFAWPRPGVLEITFRGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLLRGEGGVFSAGGS-FGLI
1hnoA           ---KISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFK---
2f6qA1          ----LVVTSEDGITKIXFNRPKKKNAINTEXYHEIXRALKAASKDDSII-TVLTGNGDYYSSGNDLDIPP
2a7kA1          ----VFEENSDEVRVITLDHPNKHNPFSRTLETSVKDALARANADDSVRAVVVGGAERSFSAGGDFNE--
1sg4A1          --------------VMKFKNPPV-NSLSLEFLTELVISLEKLENDKSFRGVILTSDPGVFSAGLDLTEMC
1o8uA           ----IRLERDGGVLLVTVHTEGKSLVWTSTAHDELAYCFHDIACDRENKVVILTGTGPSFCNEIDFTSF-
1pixA2          -------VNGKWCVVVASDNKKLAGAWVPGQAECLLRASDTAKTLH-VPLVYVLNCSGVKFDEQEKVY--
1od2A2          --------------ENLIPADPANPNSAETLIQEPGQVWHPNSAFKTAQAINDFNNGEQLPXXILANWR-
1pixA3          --------------YKAAGSVGIGGKLYRQGLVKMNEFVTLCARDR--LPIVWIQDTTGIDVGNDAEKAE
1cjdA2          --------------LIDLSTLYNENSAQAGLTPNVDFVVQYANLYRYLSTIAVFDNGGSFNAGTDINYLS
1dfcA3          -------------VLQAANERN-VSTMDLSANQDEETDQETFQDRDTKKCAFRTHTGKYWTLTATGGVQS
2f9yA1          --------------------GHQKGRETKEKIRRNFGMPAPEGYRKALRLMQMAERFKMPIITFIDTP--
1tg6A1          IVVYDIYSRLLRERIVCVMG-----PIDDSVASLVIAQLLFLQSESNKKPIHMYI----NSPGGVVTAGL
1u5tB1          ----------------------------------------------------------------------
2f9yB1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GNRSQPPSVQADSIEVLNQWIESFHAFPKPIIAAVEGPAAGAGFSLVLACDFVVAASDAKFVMAYVKVGL
1dciA           SDILQPPGDDVARIAWYQKTFTVIEKCPKPVIAAIHGGCIGGGVDLISACDIRYCTQDAFFQVKEVDVGL
1uiyA           RVTELGAEENYRHSLSLXRLFHRVYTYPKPTVAAVNGPAVAGGAGLALACDLVVXDEEARLGYTEVKIGF
1wdkA4          ENFKLPDAELIAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLEMCLAADFRVMADSAKIGLPEVKLGI
1hzdA           AKMSSSEV--GPFVSKIRAVINDIANLPVPTIAAIDGLALGGGLELALACDIRVAASSAKMGLVETKLAI
1dubA           ----QNRTFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFGQPEILLGT
1jxzA           LDKGVAGVRDHFRIAALQQMIHKIIRVKRPVLAAINGVAAGGGLGISLASDMAICADSAKFVCAWHTIGI
1ef8A           P---------LSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGV
1q51A           GDQLHI-----------LEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREARFKQTDADVGS
1wz8A1          EEMRASHEALLRVFWEARDLVLGPLNFPRPVVAAVEKVAVGAGLALALAADIAVVGKGTRLLDGHLRLGV
1hnoA           ----ETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDVYLLYPFANLGL
2f6qA1          G---GVEEKAKNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQ
2a7kA1          -VKQLRSEDIEEWIDRVIDLYQAVLNVNKPTIAAVDGYAIGMGFQFALMFDQRLMASTANFVMPELKHGI
1sg4A1          G---RSPAHYAGYWKAVQELWLRLYQSNLVLVSAINGACPAGGCLVALTCDYRILADNPRYCIGLTQLGI
1o8uA           --NLGTPHDWDEIIFEGQRLLNNLLSIEVPVIAAVNGPVTNHP-EIPVMSDIVLAAESATFDGPHFPSGI
1pixA2          --------PNRRGGGTPFFRNAELNQLGIPVIVGIYGTNPAGGGYHSISPTVIIAHEKANMAVAGIMGGM
1od2A2          GFSGGQRDXFNEVLKYGSFIVDALVDYKQPIIIYIPPTGELRGGSWVVVDPTINADQXEXYADVNARAGV
1pixA3          LLGL------------GQSLIYSIQTSHIPQFEITLRKGTAAAH-YVLGGPQGNDTNAFSIGTAATEIAV
1cjdA2          QRTANFSDTRKLDPKTRRRIATDFPKGVYYCDNRDKPIYTLQYGNVGFVVNPKTVNQNARLLMGY-----
1dfcA3          TASSKNA----------SCYFDIEWRDRRITLRASNGKFVTSKKNGQLAASVETAGDSELFLMKLI----
2f9yA1          GAYPGVGAEERGQSEAIARNLREMSRLGVPVVCTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEG--
1tg6A1          AIY----------------DTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGA
1u5tB1          --------------------KDLNSDTNYMIITLVDLYAMRIGTGLISPMEMREACEFEHLGLNELKLVK
2f9yB1          -----------------------MQERGLPYISVLTDPTGGVSASFAMLGDLNIAEPKALIGFAGPRVI-


                         +         .         .         .         .         *         .:210
query           TPDGGGSYEIARMLPRQLASEIMMEGKPVDPARLAHFGIVNRVAAPGQALTEALRIAENLAKESPNAVSG
1dciA           AADVGTLQRLPKVINRSLVNELTFTARKMMADEALDSGLVSRVFPDKDVLNAAFALAADISSKSPVAVQG
1uiyA           VAALVSVI-LVRAVGEKAAKDLLLTGRLVEAREAKALGLVNRIAPPGKALEEAKALAEEVAKNAPTSLRL
1wdkA4          YPGFGGTVRLPRLIGVDNAVEWIASGKENRAEDALKVSAVDAVVTADKLGAAALDLIKRAISGELDYKAK
1hzdA           IPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREGPVAMRV
1dubA           IPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIQCAEKIANNSKIIVAM
1jxzA           GNDTATSYSLARIVGMRRAMELMLTNRTLYPEEAKDWGLVSRVYPKDEFREVAWKVARELAAAPTHLQVM
1ef8A           PYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEKAPLAIAV
1q51A           FDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELETVGLQWAAEINAKSPQAQRM
1wz8A1          AAGDHAVLLWPLLVGMAKAKYHLLLNEPLTGEEAERLGLVALAVEDEKVYEKALEVAERLAQGPKEALHH
1hnoA           ITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFELREKVKGLYLPSCLG
2f6qA1          SPEGCSSYTFPKIXSPAKATEXLIFGKKLTAGEACAQGLVTEVFPDSTFQKEVWTRLKAFAKLPPNALRI
2a7kA1          GCSVGAAI-LGFTHGFSTMQEIIYQCQSLDAPRCVDYRLVNQVVESSALLDAAITQAHVMASYPASAFIN
1sg4A1          IAPFWLKDTLENTIGHRAAERALQLGLLFPPAEALQVGIVDQVVPEEQVQSTALSAIAQWMAIPDHARQL
1o8uA           VPGDGAHVVWPHVLGSNRGRYFLLTGQELDARTALDYGAVNEVLSEQELLPRAWELARGIAEKPLLARRY
1pixA2          NPKGHVDLEYANEIADMVDRTGKTEPPGAVDIHYTETGFMREVYASEE---GVLEGIKKYVGMLP-----
1od2A2          LEPQGXVGIKFRREKLLDTXNRLDDK-----YRELRSQLSNKSLAPEVHQQISKQLADRERELLPIYGQI
1pixA3          MNGETAATAMYSRTIDKMNNLIQAFYTKSRPKVCAELGLVDEIVDMNK-IRGYVEAFTEAAYQNPESICP
1cjdA2          ----------------------------------------------------------------------
1dfcA3          ----------------------------------------------------------------------
2f9yA1          ---CASILWKSADKAPLAAEAMGI-----IRPRLKELKLIDSIIPEPLGGAHRNPEA-------------
1tg6A1          RGQATDIAIQAEEISLQVIESAMERDRYMSPMEAQEFGILDKVL--------------------------
1u5tB1          VNKR------------------------------------------------------------------
2f9yB1          ---------------EQTVREKLPPG-FQRSEFLIEKGAIDMIVRRPEKLASILAKLMNLPAPNP-----


                         .         .         .         +         .         .         .:280
query           IKSLINHAGTATLTEHLAAERDSFVAALHHKDGGEGISAFLEKRKPNYR
1dciA           SKINLIYSRDHSVDESLDYMATWNMSMLQTQDIIKSVQAAMEKKDS---
1uiyA           TKELLLALPGXGLEDGFRLAALANAWVRETGDLAEGIRAFFEKRPPRF-
1wdkA4          RQPKLEKLKLNAIEQMMAFEAKGFVAGQAGPNYPAPVEAIKTIQKAAN-
1hzdA           AKLAINQGMEVDLVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYK
1dubA           AKESVNAAFEMTLTEGNKLEKKLFYSTFATDDRREGMSAFVEKRKANFK
1jxzA           AKERFHAGWMQPVEECTEFEIQNVIASVTHPHFMPCLTRFLDGHRAD--
1ef8A           IKEELRVLGEAHTMNSDEFERGMRRAVYDSEDYQEGMNAFLEKRKPNFV
1q51A           LKFAFNLLDDGLV-GQQLFAGEATRLAYMTDEAVEGRDAFLQKRPPDWS
1wz8A1          TKHALNHWYRSFL-PHFELSLALEFLGFSGKELEEGLKALKEKRPPEF-
1hnoA           MKKLLK-------------------------------------------
2f6qA1          SKEVIRKREREKLHAVNAEECNVLQGRWLSDEC----------------
2a7kA1          TKRAVNKPFIHLLEQTRDASKAVH-------------------------
1sg4A1          TKAMMRKATASRLVTQRDADVQNFVSFI----SKDSIQKSLQ-------
1o8uA           ARKVLTRQLRRVMEADLSLGLAHEALA----------------------
1pixA2          -------------------------------------------------
1od2A2          SLQFADLHDRSSVISKELEWTEALSHQVGEASRLEKIARIRSWY-----
1pixA3          FHQMILPRAIREFETFV--------------------------------
1cjdA2          -------------------------------------------------
1dfcA3          -------------------------------------------------
2f9yA1          -------------------------------------------------
1tg6A1          -------------------------------------------------
1u5tB1          -------------------------------------------------
2f9yB1          -------------------------------------------------