[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF07863.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1v8oA.bssp"
#ERROR : Can't open dsspfile "1v96A1.bssp"

## Summary of PDB Search
:179
    1e-04  16%  1v8oA  [c.120.1.1] HYPOTHETICAL PROTEIN PAE2754
    2e-04  13%  1v96A1 [c.120.1.1] HYPOTHETICAL PROTEIN PH0500 A:2 -- 149
:179

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxAPRVVLDSNIWVDLLVFRDPHVEXXXXXXXXXXXXXXXXXDCREE
1v8oA           -------------------------AVEYLVDASALYALAAHYDKWIKHREKLAILHLTI--------YE
1v96A1          --------------------------PDITFDSLALIKMHSQNMKRILEVTLAKFTVNLSIVT----VYR


                         .         .         *         .         .         .         .:140
query           LRRVLAYPQFTRFAVDIDAALAEVDRFTTLEPVPTQEDADAIRLPKCKDTDDQKFIELAHFSRAALLVSK
1v8oA           AGNALWKEAR-LGRVDWAAASRHLKKVXSSFKVLELDEVXRVAVERGLTFYDASYAYVA-ESSGLVLVTQ
1v96A1          YLTARLKKNIEAEFEILKDIYNIVPLLDDIAIKAAQIEANLIKKEITLDMEDIITATTAI-YTNSLLVTD


                         +         .         .         .         .         *         .:210
query           DKAVXXXXXXXXXXXGVEVLPPLAFxxxxxxxxxxxxxx
1v8oA           DR-------------------------------------
1v96A1          DPK----RYEPIRRFGLDTMPLDKF--------------