[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF07913.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1r94A.bssp"
#ERROR : Can't open dsspfile "1nwbA.bssp"

## Summary of PDB Search
:113
    1e-26  53%  1r94A  [b.124.1.1] PROTEIN YFHF
    7e-23  30%  1nwbA  [b.124.1.1] HYPOTHETICAL PROTEIN AQ_1857
:113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MFDSKAKMISMTEKAAKHVARYLEXXXXXXXXXXXXXXXXCSGLAYKLEYVDEVLPEDQVFETHGIKVIV
1r94A           --------ITLSDSAAARVNTFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPTPEDIVFEDKGVKVVV
1nwbA           MQEQAQQFFKVTDKAVEEIKKVAQENNIENPILRIRVVPGCSGFQYAMGFDDTVEEGDHVFEYDGVKVVI


                         .         .         *         .         .         .         .:140
query           DPKSLPYIDGTELDFAREGLNEGFKFNNPNVKDxxxxxxxxxx
1r94A           DGKSLQFLDGTQLDFVKEGLNEGFKFTNPNVKD----------
1nwbA           DPFSMPYVNGAELDYVVDFMGGGFTIRNP--------------