[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF07921.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1pwxA.bssp"
#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "1yb1A.bssp"
#ERROR : Can't open dsspfile "1bdbA.bssp"
#ERROR : Can't open dsspfile "1zemA1.bssp"
#ERROR : Can't open dsspfile "1xg5A.bssp"
#ERROR : Can't open dsspfile "2gdzA1.bssp"
#ERROR : Can't open dsspfile "1c14A.bssp"
#ERROR : Can't open dsspfile "2ag5A1.bssp"
#ERROR : Can't open dsspfile "1nasA.bssp"
#ERROR : Can't open dsspfile "1di6A.bssp"
#ERROR : Can't open dsspfile "1jr2A.bssp"
#ERROR : Can't open dsspfile "1u7uA.bssp"
#ERROR : Can't open dsspfile "1w6uA.bssp"
#ERROR : Can't open dsspfile "1h5qA.bssp"
#ERROR : Can't open dsspfile "1vhcA.bssp"
#ERROR : Can't open dsspfile "1lu9A1.bssp"
#ERROR : Can't open dsspfile "1spxA.bssp"
#ERROR : Can't open dsspfile "1nytA1.bssp"
#ERROR : Can't open dsspfile "1h2iA.bssp"
#ERROR : Can't open dsspfile "1dhrA.bssp"
#ERROR : Can't open dsspfile "1xseA.bssp"
#ERROR : Can't open dsspfile "1yo6A1.bssp"
#ERROR : Can't open dsspfile "2zqnA1.bssp"
#ERROR : Can't open dsspfile "1qorA2.bssp"
#ERROR : Can't open dsspfile "1fjhA.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "2c54A1.bssp"
#ERROR : Can't open dsspfile "1yxmA1.bssp"
#ERROR : Can't open dsspfile "1a4uA.bssp"
#ERROR : Can't open dsspfile "1x74A1.bssp"
#ERROR : Can't open dsspfile "1snyA.bssp"
#ERROR : Can't open dsspfile "1o5iA.bssp"
#ERROR : Can't open dsspfile "1zbqA1.bssp"
#ERROR : Can't open dsspfile "1gu7A2.bssp"
#ERROR : Can't open dsspfile "1adeA.bssp"

## Summary of PDB Search
:256
    1e-15  17%  1pwxA  [c.2.1.2] HALOHYDRIN DEHALOGENASE
    6e-14  18%  1a27A  [c.2.1.2] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    5e-13  19%  1yb1A  [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
    5e-13  13%  1bdbA  [c.2.1.2] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
    6e-13  19%  1zemA1 [c.2.1.2] XYLITOL DEHYDROGENASE A:3 -- 262
    6e-12  18%  1xg5A  [c.2.1.2] ARPG836
    3e-11  23%  2gdzA1 [c.2.1.2] NAD+-DEPENDENT 15-HYDROXYPROSTAGLANDIN A:3 -- 256
    2e-10  13%  1c14A  [c.2.1.2] ENOYL REDUCTASE
    8e-10  17%  2ag5A1 [c.2.1.2] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6 A:1
    1e-09  21%  1nasA  [c.2.1.2] SEPIAPTERIN REDUCTASE
    2e-09  12%  1di6A  [c.57.1.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    2e-09   7%  1jr2A  [c.113.1.1] UROPORPHYRINOGEN-III SYNTHASE
    5e-09   7%  1u7uA  [c.72.3.1] COENZYME A BIOSYNTHESIS BIFUNCTIONAL PROTEIN
    7e-09  15%  1w6uA  [c.2.1.2] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    9e-09  17%  1h5qA  [c.2.1.2] NADP-DEPENDENT MANNITOL DEHYDROGENASE
    1e-08   9%  1vhcA  [c.1.10.1] PUTATIVE KHG/KDPG ALDOLASE
    1e-08  12%  1lu9A1 [c.2.1.7] METHYLENE TETRAHYDROMETHANOPTERIN DEHYDROGENASE
    3e-08  20%  1spxA  [c.2.1.2] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5L265)
    9e-08   9%  1nytA1 [c.2.1.7] SHIKIMATE 5-DEHYDROGENASE A:102 -- 271
    1e-07   5%  1h2iA  [d.50.1.3] DNA REPAIR PROTEIN RAD52 HOMOLOG
    4e-07  13%  1dhrA  [c.2.1.2] DIHYDROPTERIDINE REDUCTASE
    6e-07  17%  1xseA  [c.2.1.2] 11BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 1
    6e-07  31%  1yo6A1 [c.2.1.2] PUTATIVE CARBONYL REDUCTASE SNIFFER A:1 -- 250
    1e-06   4%  2zqnA1 [b.42.2.1] 29-KDA GALACTOSE-BINDING LECTIN A:131 -- 260
    1e-06   3%  1qorA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:113 -- 291
    1e-06  24%  1fjhA  [c.2.1.2] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL
    2e-06  17%  1dohA  [c.2.1.2] TRIHYDROXYNAPHTHALENE REDUCTASE
    2e-06   6%  2c54A1 [c.2.1.2] GDP-MANNOSE-3', 5'-EPIMERASE A:13 -- 374
    3e-06  16%  1yxmA1 [c.2.1.2] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE A:7 -- 303
    3e-06  17%  1a4uA  [c.2.1.2] ALCOHOL DEHYDROGENASE
    3e-06  11%  1x74A1 [c.123.1.1] 2-METHYLACYL-COA RACEMASE A:2 -- 360
    6e-06  18%  1snyA  [c.2.1.2] SNIFFER CG10964-PA
    8e-06  15%  1o5iA  [c.2.1.2] 3-OXOACYL-(ACYL CARRIER PROTEIN) REDUCTASE
    2e-05  16%  1zbqA1 [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE 4 A:3 -- 304
    2e-05   8%  1gu7A2 [c.2.1.1] 2,4-DIENOYL-COA REDUCTASE A:161 -- 349
    2e-05   9%  1adeA  [c.37.1.10] ADENYLOSUCCINATE SYNTHETASE
:256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRVIGVARSRNPELEAEATASGVRVAWHLQDLSQPGP
1pwxA           ----------------------------------TVACHDESFKQKDELEAFAETYP---QLKPMSEQEP
1a27A           ---------------------------------------------EAARALACPPGSLETLQLDVRDS--
1yb1A           ---------------------------------------------ETAAKCKGLGAKVHTFVVDCSNRE-
1bdbA           ----------------------------------KVAVLDK-SAERLAELETDHGDNVLGIVGDVRSLED
1zemA1          ---------------------------------------------KAEASVREKGVEARSYVCDVTSEEA
1xg5A           -----------------------------------------------ECKSAGYPGTLIPYRCDLSNE--
2gdzA1          -----------------------------------------------ALHEQFEPQKTLFIQCDVADQ--
1c14A           ----------------------------------ELAFTYQNKLKGRVEEFAAQLGSDIVLQCDVAED--
2ag5A1          ----------------------------------KVIATDINESK---LQELEKYPGIQTRVLDVTKK--
1nasA           ---------------------------------------------GAQQPDLKVVLAAADLGTEAGVQRL
1di6A           -----------------------------------SISDRDKGIPALEEWLTSALTTPFELETR--LIPD
1jr2A           ----------------------------------------------------------------------
1u7uA           ------------------------------------IAAAAARRGANVTLVSGPVSLPTPPFVKRVDVM-
1w6uA           ----------------------------------QCVIASRKMDVTAEQISSQTGNKVHAIQCDVRDPD-
1h5qA           ------------------------------------------RSAADAVEVTEKGVKTKAYQCDVSNTD-
1vhcA           ----------------------------------------------------------------------
1lu9A1          ----------------------------------EVVLCGRKLDKQAAADSVNKRFKVNVTAAETADD--
1spxA           ----------------------------------------------------------------------
1nytA1          ----------------------------------------------------------------------
1h2iA           -------------------------------------QYTAEEYQAIQKALRQRLGPEYISSRMAGGG--
1dhrA           -----------------------------------VYGGRGALGSRCVQAFRARNWWVASIDVVENEEAS
1xseA           ----------------------------------------------------------------------
1yo6A1          ----------------------------------------------------------------------
2zqnA1          ----------------------------------------------------------------------
1qorA2          ----------------------------------------------------------------------
1fjhA           ------------------------------------------------HQIVGIDIRDAEVIADLSTA--
1dohA           ----------------------------------------------------------------------
2c54A1          ----------------------------------------------------------------------
1yxmA1          ----------------------------------------------------------------------
1a4uA           ----------------------------------------------------------------------
1x74A1          ----------------------------------------------------------------------
1snyA           ----------------------------------HLFTTCRNREQKELEDLAKNHSNIHILEIDLRNFDA
1o5iA           ----------------------------------------------------------------------
1zbqA1          ----------------------------------DFKGVGKGS-LAADKVVEEIRRRGGKAVANYDSVEE
1gu7A2          ----------------------------------------------------------------------
1adeA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SAGWLASVLDAVEEAPASITLILNAGVVEPIGPITQLHDSTLVPHLQTNLVTPMTMTGAFIEHTVRFDCP
1pwxA           -----AELIEAVTSAYGQVDVLVNDIFAPEFQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSG
1a27A           -----KSVAAARERVTERVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKR-RGS
1yb1A           ---DIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHG
1bdbA           QKQAASRCVARFGKIDTLIPNAGWDYSTALVDLPEESLDAAFDEVFHINVKGYIHAVKACLPALVASR--
1zemA1          VIGT---VDSVVRDFGKIDFLFNNAGYQGAFAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQN-Y
1xg5A           -EDILSMFSAIRSQHSGVDICINNAGLARP-DTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVD
2gdzA1          -----QQLRDTFRKVVDHFILVNNAGVNNEKNWEK---------TLQINLVSVISGTYLGLDYMSKQNGG
1c14A           -ASIDTMFAELGKVWPKFDGFVHSIGFAPGGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPG---
2ag5A1          -----KQIDQFANEVERLDVLFNVAGFV-HHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSG
1nasA           LSAVRELPRPEGLQRLLLINNAATLGD-VSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGL
1di6A           EQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVT-------PDATLAVADREMPGFGEQMRQISLHFVP
1jr2A           -----------------------------------------------PGIQGNLNSYYSQQGVPASITFF
1u7uA           ---TALEMEAAVNASVQQQNIFIGCAAVADYRAALTIKMVKNPDIVAGVAALKDHRPYVVGFAAETNNV-
1w6uA           ---MVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKG
1h5qA           ---IVTKTIQQIDADLGPISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKQQK
1vhcA           ------------------------------------------------------------------SAVK
1lu9A1          -----ASRAEAVKGAHFVF-TAGAIGLE-LLPQAAWQNESSIEIVADYNAQPPLGIGGIDATDKGKEYGG
1spxA           ----------------------------------------------------VIALTKKAVPHLSSTKG-
1nytA1          -TGSIQALSMDELEGHEFDLIINATSSGISG-DIPAIPSSLIHPGIYCYDMFYQKGKTPFLAWCEQRGSK
1h2iA           -----QKVCYIEGHRVINLAMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYG
1dhrA           ASVIVAEVGKLLGDQKVDAILCVAGGWAGG-NAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGL-
1xseA           ------------------------------------------------------------------MQSQ
1yo6A1          ----------------------------------------------------------------------
2zqnA1          -----------------------------------------------FFYIKSELNGKVLDIEGQNPAPG
1qorA2          --------------------------------------------RGLMVSFGNSSGAVTGVNLGILNQKG
1fjhA           -EGRKQAIADVLAKCSKGMGLVLCAGL----GPQTKVLGNVV----SVNYFGATELMDAFLPALKKGHQP
1dohA           ---------------------CSNSGVVSFG-HVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRL
2c54A1          -----------------------QSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLET
1yxmA1          ------------------------------------------------------------------MKEH
1a4uA           ----------------------------------------------------------------------
1x74A1          -------SDQGLELALKLIAKADVLIEGYRPGVTERLGLGPEECAKVNDRLIYARMTGWGQTG-PRSQQA
1snyA           YDKLVADIEGVTKDQGLNVLFNNAGIAP-KSARITAVRSQELLDTLQTNTVVPIXLAKANESQPXGVGRA
1o5iA           --------------------------------------------AIDSLFLNMIKIVRNYLPAMKEKGWG
1zbqA1          GEKVVKTA----LDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHM-KKQKY
1gu7A2          -----------------------CVGGKSSTGIARKLNNNGLM--LTYGGMSFQPVTIPTSLYIFKNFTS
1adeA           -------------------------------------------FVMFEGAQGTLLDIDHGTYPYVTSSNT


                         +         .         .         .         .         *         .:210
query           RKVLAISSGAARNPVPGWSAYCAGKAGLDMFIRSVNTEYASVPEPRTLRAVALAPGVVDTGMQETIRGAD
1pwxA           HIIF-ITSATPFGPWKELSTYTSARAGACTLANALSKELG----EYNIPVFAIGPNYLHSEDSPYFYPTE
1a27A           GRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLL----PFGVHLSLIECGPVHTAFMEKVLGSP
1yb1A           HIVTVASAAHV--SVPFLLAYCSSKFAAVGFHKTLTDELAAL-QITGVKTTCLCPNFVNTGFIKNPSTSL
1bdbA           GNVIFTISNAGFYPNGGGPLYTAAKHAIVGLVRELAFELA-----PYVRVNGVGSGGINSDLRGPSS--L
1zemA1          GRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLA----PYNIRVNAISPGYMGPGFMWERQVEL
1xg5A           DHIININSGHRVLPLSVTHFYSATKYAVTALTEGLRQELR--EAQTHIRATCISPGVVETQFAFKLHDKD
2gdzA1          EGIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSA--ALAANLMNSGVRLNAICPGFVNTAILESIEGQY
1c14A           SALLTLSYLGAERAIPNYNVMGLAKASLEANVRYM----ANAMGPEGVRVNAISAGPIRTLAASGIK-DF
2ag5A1          NIINMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADF----IQQGIRCNCVCPGTVDTPSLQERIQAR
1nasA           STVVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEEPSV------RVLSYAPGPLDNDMQQLARETS
1di6A           TAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKDAEGN----VVVHGIFASVPYCIQLLEGPYVETAP
1jr2A           SPS-GLTYSLKHIQELSGDNIDQIKFAAIGPTTAR--ALA----AQGLPVSCTAESPTPQALATGIR---
1u7uA           --EEYARQKRIRKNLDLICANSDNNALHLFWQD-------------------------------------
1w6uA           AAFLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWG----KYGMRFNVIQPGPIKTLDP-------
1h5qA           GSIVVTSSMSSQNGSLTQVFYNSSKAACSNLVKGLAAEWA----SAGIRVNALSPGYVNTDQTAHMDKKI
1vhcA           FFPAEASGGVKXIKALLGPYAQLQIXPTGGIGLHNIRDYL----AIPNIVACGGSWFVEKKLQSNNWDEI
1lu9A1          KRALGIGGLKLKLHRACIAKLFESSEGVFDAEEIYKLAK-------------------------------
1spxA           EIVNISSIASGLHATPDFPYYSIAKAAIDQYTRNTAIDLI----QHGIRVNSISPGLVATGF--------
1nytA1          RNAD-GLGMLVAQAAHAFLLWHGVLPDVEPVIKQLQEELS------------------------------
1h2iA           VSEGLKSKALSLEKARKEAVTDGLKRALRSF-----GNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAK
1dhrA           --LTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKN--SGMPSGAAAIAVLPVTLDTPMNRKSMPEA
1xseA           GSIAVVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFL--VNKVNVSITLCILGLIDTETAIKATSGI
1yo6A1          ---------------FPVLAYRMSKAAINMFGRTLAVDLKD----DNVLVVNFCPGWVEQSTAELISKLD
2zqnA1          S-KIITWDQKKGPTAVNQLWYTDQQGVIRSKLNDFAIDAS----HEQIETQPFDPNNPKRAWIVSGNTIA
1qorA2          SLYVTRPSLQGYITTREELTEASNELF-SLIASGV-----------------------------------
1fjhA           AAVVISSVASAHGEQGGNLAYAGSKNALTVAVRKRAAAWG----EAGVRLNTIAPGAFVPPMGRRAEPSE
1dohA           ILM--GSITGQAKAVPKHAVYSGSKGAIETFARCMAIDM----ADKKITVNVVAPGGIKTDMYHAVC---
2c54A1          --TNVSLKESDAWPAEPQDAYGLERLATEELCKHYNKDFG----IECRIGRFHNIYGPFGTWKGGREK--
1yxmA1          GGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWA----CSGIRINCVAPGVIYSQTAVENYGSW
1a4uA           ----------GFNAIHQVPVYSASKAAVVSFTNSLAKLAP----ITGVTAYSINPGITRTPLVHTFNSWL
1x74A1          GHDINYISLNGILHAIGRGDERPVPPLNLVGDFGGGSMFL------------------------------
1snyA           AIINXSSILIQGNTDGGXYAYRTSKSALNAATKSLSVDLY----PQRIXCVSLHPGWVKTDXGGSSAPLD
1o5iA           RIV-AITSFSVISPIENLYTSNSARMALTGFLKTLSFEVA----PYGITVNCVAPGWTETERVKELLSEE
1zbqA1          GRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGR----KSNIHCNTIAPNAGSRMTQT------
1gu7A2          A-GFWVTELLK----NNKELKTSTLNQIIAWYEE------------------------------------
1adeA           TAGG-VATGSGLGPRYVDYVLGILKAYSTRV---------------------------------------


                         .         .         .         +         .         .         .:280
query           FAQVQRFRDLKDNEQLASPDDTARRIVAYLARPDFGTTELxxxxxx
1pwxA           PWHVAHVKKVTALQRLGTQKELG-ELVAFLASGS------------
1a27A           EEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPE------------
1yb1A           GPTLE-------------PEEVVNRLMH------------------
1bdbA           GPLADMLKSVLPIGRMPEVEEYT-GAYVFFATRG------------
1zemA1          QAKVGSQYFSTDPKVYGDINEIP-GVVAFLLGDD------------
1xg5A           PEKAAATY------ECLKPEDVAEAVIYVLSTP-------------
2gdzA1          IEYKDHIKDMIKYYGILDPPLIANGLI-TLI---------------
1c14A           RKMLAHCEAVTPIRRTVTIEDVG-NSAAFLCSDL------------
2ag5A1          GN--------------------------------------------
1nasA           KDPELRSKLQKLKGALVDCGTSA-QKLLGLLQKDTFQS--------
1di6A           ----------------------------------------------
1jr2A           ----------------------------------------------
1u7uA           ----------------------------------------------
1w6uA           ----------------------------------------------
1h5qA           RDHQASNIPLNRF---AQPEEMT-GQAILLLSDH------------
1vhcA           GRLVREVID-------------------------------------
1lu9A1          ----------------------------------------------
1spxA           YSTMATMKECVPAGVMGQPQDIA-EVIAFLADRK------------
1nytA1          ----------------------------------------------
1h2iA           RQDL------------------------------------------
1dhrA           DFSSWTP-----------LEFLV-ETFHDWITGN------------
1xseA           YL-----------GPASPKEECALEIIKGTALRQDEMYYV------
1yo6A1          NSHNGRFRNLK-----------------------------------
2zqnA1          QLSDRDIVLDI---IKSDKEAGA-HICAWKQHGG------------
1qorA2          ----------------------------------------------
1fjhA           MASVIAF--------LMSPA--------------------------
1dohA           ----------------------------------------------
2c54A1          ----------------------------------------------
1yxmA1          GQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPA------------
1a4uA           DVE-PRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAI--------
1x74A1          ----------------------------------------------
1snyA           VPTS------------------------------------------
1o5iA           KKKQVESQIPMRRMAKPEEIASV---VAFLCSEK------------
1zbqA1          ----------------------------------------------
1gu7A2          ----------------------------------------------
1adeA           ----------------------------------------------