[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF07939.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1rzmA.bssp"
#ERROR : Can't open dsspfile "1d9eA.bssp"
#ERROR : Can't open dsspfile "1vliA2.bssp"
#ERROR : Can't open dsspfile "1xuuA2.bssp"
#ERROR : Can't open dsspfile "1jkwA2.bssp"
#ERROR : Can't open dsspfile "1cqiA1.bssp"
#ERROR : Can't open dsspfile "1gg1A.bssp"
#ERROR : Can't open dsspfile "1f6yA.bssp"

## Summary of PDB Search
:289
    2e-78  32%  1rzmA  [c.1.10.4] PHOSPHO-2-DEHYDRO-3-DEOXYHEPTONATE ALDOLASE
    3e-72  45%  1d9eA  [c.1.10.4] 3-DEOXY-D-MANNO-OCTULOSONATE 8-PHOSPHATE
    3e-40  16%  1vliA2 [c.1.10.6] SPORE COAT POLYSACCHARIDE BIOSYNTHESIS PROTEIN
    3e-12  18%  1xuuA2 [c.1.10.6] POLYSIALIC ACID CAPSULE BIOSYNTHESIS PROTEIN A:2
    1e-10  13%  1jkwA2 [a.74.1.1] CYCLIN H A:162 -- 287
    4e-07  27%  1cqiA1 [c.2.1.8] PROTEIN (SUCCINYL-COA SYNTHETASE ALPHA CHAIN) A:1
    5e-05  29%  1gg1A  [c.1.10.4] 3-DEOXY-D-ARABINO-HEPTULOSONATE-7-PHOSPHATE
    7e-04  11%  1f6yA  [c.1.21.2] 5-METHYLTETRAHYDROFOLATE CORRINOID/IRON SULFUR
:289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKLCGFDVGLDKPFFLIAGPCVIESEQMALDTAGELKAITGELGIPFIYKSSFDKANRSSGKSFRGLGME
1rzmA           IDLGDVKIG-NGYFTIIAGPCSVEGREMLMETAHFLS----ELGVKVLRGGAYKP--RTSPYSFQGLG-E
1d9eA           VSIGDINVANDLPFVLFGGMNVLESRDLAMRICEHYVTVTQKLGIPYVFKASFDKANRSSIHSYRGPGLE
1vliA2          FQIANKTVGKDAPVFIIAEAGINHDGKL--DQAFALIDAAAEAGAXFQADRXYQKDPDVSIFSLVQSXEA
1xuuA2          FKIGNRSVGYNHEPLIICEIGILKTAFEMVDAAYNAGAIVEDEMSDEAKQVIPGNADVSIYEIMERCALE
1jkwA2          ----------------------------------------------------------------RYPILE
1cqiA1          ----------------------------------------------------------------------
1gg1A           --------GNDDRLLVVIGPCSIHDPVAAKEYATRLLALREELKLEIVMRVYFEKPRTTVGHMDNSFQIN
1f6yA           -------------------------------------------------------------------KVS


                         .         .         *         .         .         .         .:140
query           KGLEILATVKRQIGVPVLTDIHEIDEIKPVAAVVDVLQTPAFLCRQTDFIRACAQSGKPVNIKKGQFLAP
1rzmA           KGLEYLREAADKYGMYVVTEALGEDDLPKVAEYADIIQIGARNAQNFRLLSKAGSYNKPVLLKRGFMNTI
1d9eA           EGMKIFQELKQTFGVKIITDVHEPSQAQPVADVVDVIQLPAFLARQTDLVEAMAKTGAVINVKKPQFVSP
1vliA2          EWILPLLDYCREKQVIFLSTVCDEGSADLLQSTPSAFKIASYEINHLPLLKYVARLNRPXIFSTA-GAEI
1xuuA2          EDEIKLKEYVESKGMIFISTPFSRAAALRLQRMIPAYKIGSGECNNYPLIKLVASFGKPIILSTG-----
1jkwA2          NPEILRKTADDFLNRIALTDAYLLYTPSLSSASRAGITMESYLSESLMLKENRTCLSQLLDIKKYEPPRS
1cqiA1          -------------GLPVFNTVREAVAATGATASVIY--VPAPFCK--DSILEAIDAGIKLIITITEGIPT
1gg1A           DGLRIA----RKL----LLDINDSG----LPAAGEFLDTPQYLA--------------------------
1f6yA           AMEWLVEVTQEVSNLTLCLDSTNIKAIEKKCKNRAMINSTNAEREKVEKLFPLAEHGAALMNKTGIPKDS


                         +         .         .         .         .         *         .:210
query           HDMKNVIDKARDAAREAGLPDDVFMACERGVSFGYNNLVSDMRSLAIMRETGAPVVFDATHSVQLPGGQG
1rzmA           EEFLLSAEY----IANSGNTK--IILCERGIREKATRNTLDISAVPIIRESHLPILVDPSH---------
1d9eA           GQMGNIVDK----FKEGGNEK--VILCDRGANFGYDNLVVDMLGFSIMKKGNSPVIFDVTH---------
1vliA2          SDVHEAWRTIRAEGN------NQIAIXHCVAKYPAPPEYSNLSVIPXLAAFPEAVIGFSDHSEH------
1xuuA2          --MNSIIKKSVEIIREAG-VPYALLHCTNIYPTPYEDV--RLGGMNDLSEAFPDAIIGSDHTL-------
1jkwA2          EEVAVLKQKLDRCH--------------------------------------------------------
1cqiA1          LDMLTVKVKLDEA---------------------------------------------------------
1gg1A           ----------------------------------------------------------------------
1f6yA           DTRLAFAMELVAAADEFGLPME-DLYIDPLILPAAPEVLKTLQQIKMLADPAPKTVLGLSNSQNCQNRPL


                         .         .         .         +         .         .         .:280
query           TSSGGQREFVPVLSRAAVATGVAGLFMETHPDPSKAMSDGPNAVPLSRMKELLTVLRDLDGMVKRAGFLE
1rzmA           --SGGRRDLVIPLSRAAIAVGAHGIIVEVHPEPEKALSDGKQSLDFELFKELVQEMKKLADALGV-----
1d9eA           ---ALQRAQVAELARAGMAVGLAGLFIEAHPDP------EPSALPLAKLEPFLKQMKAIDDLVKGFEELD
1vliA2          ---------PTEAPCAAVRLGAKLIEKHFTIDKNLPGADHSFALNPDELKEXVDGIRKTEAELKQ-----
1xuuA2          ---------DNYACLGAVALG--GSILERHFTDRMDRPDIVCSMNPDTFKELKQGAH-------------
1jkwA2          ----------------------------------------------------------------------
1cqiA1          ----------------------------------------------------------------------
1gg1A           ----------------------------------------------------------------------
1f6yA           INR--------TFLAMAMACGLMSA---------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxx
1rzmA           ---------
1d9eA           ---------
1vliA2          ---------
1xuuA2          ---------
1jkwA2          ---------
1cqiA1          ---------
1gg1A           ---------
1f6yA           ---------