[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF07996.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1hkvA2.bssp"
#ERROR : Can't open dsspfile "1d7kA2.bssp"
#ERROR : Can't open dsspfile "1knwA2.bssp"
#ERROR : Can't open dsspfile "1hkvA1.bssp"
#ERROR : Can't open dsspfile "1knwA1.bssp"
#ERROR : Can't open dsspfile "1bd0A2.bssp"
#ERROR : Can't open dsspfile "1rcqA2.bssp"
#ERROR : Can't open dsspfile "1tufA2.bssp"
#ERROR : Can't open dsspfile "1b54A.bssp"
#ERROR : Can't open dsspfile "1u1hA1.bssp"
#ERROR : Can't open dsspfile "1d7kA1.bssp"
#ERROR : Can't open dsspfile "2bhrA1.bssp"

## Summary of PDB Search
:397
    4e-39  27%  1hkvA2 [c.1.6.1] DIAMINOPIMELATE DECARBOXYLASE A:46 -- 310
    2e-35  23%  1d7kA2 [c.1.6.1] HUMAN ORNITHINE DECARBOXYLASE A:44 -- 283
    1e-34  28%  1knwA2 [c.1.6.1] DIAMINOPIMELATE DECARBOXYLASE A:32 -- 278
    1e-22  17%  1hkvA1 [b.49.2.3] DIAMINOPIMELATE DECARBOXYLASE A:2 -- 45 A:311 --
    9e-22  22%  1knwA1 [b.49.2.3] DIAMINOPIMELATE DECARBOXYLASE A:2 -- 31 A:279 --
    2e-20  19%  1bd0A2 [c.1.6.1] ALANINE RACEMASE A:12 -- 244
    1e-19  18%  1rcqA2 [c.1.6.1] CATABOLIC ALANINE RACEMASE DADX A:8 -- 233
    3e-19  24%  1tufA2 [c.1.6.1] DIAMINOPIMELATE DECARBOXYLASE A:50 -- 313
    5e-16  11%  1b54A  [c.1.6.2] YEAST HYPOTHETICAL PROTEIN
    4e-14  11%  1u1hA1 [c.1.22.2] 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE-- A:2 --
    9e-11  20%  1d7kA1 [b.49.2.3] HUMAN ORNITHINE DECARBOXYLASE A:7 -- 43 A:284 --
    2e-10   9%  2bhrA1 [c.37.1.14] RNA HELICASE A:483 -- 618
:397

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPEQCALYYAVKANSDAPVLRALLGVADGFE
1hkvA2          ----------------------------------------GSGANVHYAAKAFLCSEVARWISEEGLCLD
1d7kA2          ---------------------------------------------PFYAVXCNDSKAIVKTLAATGTGFD
1knwA2          ---------------------------------------------VRFAQKACSNIHILRLMREQGVKVD
1hkvA1          ----------------------------------------------------------------------
1knwA1          ----------------------------------------------------------------------
1bd0A2          ----------------------------------------PDDTHIMAVVKANAYGHGDVQVARTASRLA
1rcqA2          ---------------------------------------------ALAVIKADAYHGAVRALAAEADGFA
1tufA2          -------------------------------------------FIVAYAYXANANLAITRLLAKLGCGAD
1b54A           --------------------------------------------------KLKPASDIQILYDHGVREFG
1u1hA1          ----------------------------------------------FADIPAEAYKTLTSLKGVTAFGFD
1d7kA1          ----------------------------------------------------------------------
2bhrA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VASFGEIERVRGVDAEVPIAFGGPGKTDAELEGALRLGVGLIHVESTLQLSRLDAVARRQGRCADVLLRA
1hkvA2          VCTGGELAVALSFPPE-RITLHGNNKSVSELTAAVKAGVGHIVVDSMTEIERLDAIAGEAGIVQDVLVRL
1d7kA2          CASKTEIQLVQGVPPE-RIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLV----LRI
1knwA2          SVSLGEIERALGYNPQTHIVFTADVIDQATLERVSELQI-PVNAGSVDMLDQLGQVSPG----HRVWLRV
1hkvA1          ----------------------------------------------------------------------
1knwA1          ----------------------------------------------------------------------
1bd0A2          VAFLDEALALRGIEAPI-LVLGASRPADAALAAQQRIALTVFRSDWLEEASAL----YSGPFPIHFHLKM
1rcqA2          VACIEEGLELREAGIRQPILLLEGFFEASELELIVAHDF-WCVVHCAWQLEAIERASLA----RPLNVW-
1tufA2          VVSGGELYIAKNVPSKK-IVFNGNCKTKEEIIMGIEANIRAFNVDSISELILINETAKELGETANVAFRI
1b54A           ENYVQELIEKALPDDIK-WHFIGGLQTNKCKDLAKVPNLYSVETIDSLKK------AKKLNESRAKFQPD
1u1hA1          LVRGTKTLDLAGFPEG-KYLFAGVVDGRNIWANDFAASLSTLQLEGIVGKDKLVVSTSCSLLHTAVDLIN
1d7kA1          ----------------------------------------------------------------------
2bhrA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NPAYGLPGATLQMGGGATQFGIDEALLPDVLAQSRTMPNVRVVGLHVHAGSNSLDADTHLALIDRHIALA
1hkvA2          TVGVAHTHEFISTAHEDQKFGLSVASGAAMAAVRRATDHLRLVGLHSHIGSQIFDVDGFELAAHRVIGLL
1d7kA2          AT-----DDSKAVCRLSVKFGATLRTSRLLLERAKEL-NIDVVGVSFHVGSGCTDPETFVQAISDARCVF
1knwA2          NPGFGHGHSQKNTGGENSKHGIWYTDLPAALDVIQ-RHHLQLVGIHMHIGSGVDYAH----LEQVCGAMV
1hkvA1          ----------------------------------------------------------------------
1knwA1          ----------------------------------------------------------------------
1bd0A2          DTGMG------------RLGVKDEEETKRIVALIERHPHFVLEGLYTHFATDEVNTDYFSYQYTRFLHML
1rcqA2          ----------LXMDSGMHRVGFFPEDFRAAHERLRASGKVAKIVMMSHFSRADELDCPRTEQLAAFSAAS
1tufA2          NPNVNPKTHPKISGLKKNKFGLESGIAMKAIKMALEMEYVNVVGVHCHIGSQLTDISPFIEETRKVMDFV
1b54A           CNPILC-NVQINTSHEDQKSGLNNEAEIFEVIDFFECKYIKLNGLMTIGSWENRD--------FATLVEW
1u1hA1          E--------TKLDDEIKSWXAFAAQKVVEVNALAKALAGQK-----------------------------
1d7kA1          ----------------------------------------------------------------------
2bhrA1          --------------AHWKEAKMLLDNINTPEGIIPSMFEPEREKVDAIDGEARKTFVDLMRRGDLPVWLA


                         .         .         .         +         .         .         .:280
query           KRLRDLHGLTLEWLNVGGGIGIDYQNPERHFDWDRFCHGLAALLRETAPSTRIVFECGRFISAGCGCYVA
1hkvA2          RDVVGEKTAQIATVDLGGGLGISYLPSDDPPPIAELAAKLGTIVSDESTAVKLVVEPGRAIAG-------
1d7kA2          DMGAEV-GFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVA-------
1knwA2          RQVIE-FGQDLQAISAGGGLSVPYQQGEEAVDTEHYYGLWNAAREQIARHVKLEIEPGRFLVAQSG----
1hkvA1          ----------------------NELLHLAPNVWRNTTRDEVGVVCIAGPLTQLAQEYGTPLFVIITLYEV
1knwA1          ------------------------------------------------TDTDLTAENLLRLPAEFGCPVW
1bd0A2          EWLP-SRPPLVHCANSAASLRF----PDRTFNMVRFGIAMLAPSPGIKPLLPYPLK--------------
1rcqA2          QGLEGEIKVPSDWVRPGILLGATPFERAHPLADR------------------------------------
1tufA2          VELKEE-GIEIEDVNLGGGLGIPYYKDKQIPTQKDLADAIINTMLKYKDKPNLILEPGRSLVA-------
1b54A           KKKIDAKFGTSLKLSMGMSADFRE-AIRQGTAEVRIGTDI------------------------------
1u1hA1          ----------------------------------------------------------------------
1d7kA1          -------------------------------------------LDQKINEVSSSDDKDAFYVAFTLAVIA
2bhrA1          YRVA-AEGINYADRRWCFDGVKNNQ-ILEENVEVEIWTKERKKLKPRWLDARIYSDPLALKE--------


                         .         *         .         .         .         .         +:350
query           EVIDLKRNHDKWFAVLRGGTHHFRLPVSWQHNHPFQVLPNDHWDYPFPRPVVERQPVTLCGELCTPKDVL
1hkvA2          ----------------------------------------------------------------------
1d7kA2          ----------------------------------------------------------------------
1knwA2          ----------------------------------------------------------------------
1hkvA1          KDVDVSATAHRRYVSVDGGMSDNIRTALYGAQYDVRLVS--------RVSDAPPVPARLVGKHCESGDII
1knwA1          VYVSVKQMGSRHFVLVDAGFNDLMRPAMYGSYHHISALAADGR----SLEHAPTVETVVAGPLCESGDVF
1bd0A2          ----------------------------------------------------------------------
1rcqA2          ----------------------------------------------------------------------
1tufA2          ----------------------------------------------------------------------
1b54A           ----------------------------------------------------------------------
1u1hA1          ----------------------------------------------------------------------
1d7kA1          KKIVLKEQTEQMYYVNDGVYGSFN-CILYDHAHVKPLLQKR------PKPDERYYSSSIWGPTCDGLDRI
2bhrA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           AREVPVDRLRVGDRIAFTMAGAYGWHISHHDFLSHPHPERVFIxxxx
1hkvA2          -----------------------------------------------
1d7kA2          -----------------------------------------------
1knwA2          -----------------------------------------------
1hkvA1          VRDTWVPDIRPGDLVAVAATGAYCYSLSSR-YNMVGRPAVVAV----
1knwA1          TQQEALPEVKAGDYLVLHDTGAYGASMSSN-YNSRPLLPEVLF----
1bd0A2          -----------------------------------------------
1rcqA2          -----------------------------------------------
1tufA2          -----------------------------------------------
1b54A           -----------------------------------------------
1u1hA1          -----------------------------------------------
1d7kA1          VERCDLPEMHVGDWMLFENMGAYTVAAA-STFNGFQRPTIYYV----
2bhrA1          -----------------------------------------------