[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF08007.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1iwgA7.bssp"
#ERROR : Can't open dsspfile "1iwgA8.bssp"
#ERROR : Can't open dsspfile "1mwkA2.bssp"
#ERROR : Can't open dsspfile "1e6vB2.bssp"
#ERROR : Can't open dsspfile "1iwgA1.bssp"
#ERROR : Can't open dsspfile "1iwgA4.bssp"
#ERROR : Can't open dsspfile "1iwgA5.bssp"
#ERROR : Can't open dsspfile "1iwgA6.bssp"
#ERROR : Can't open dsspfile "1iwgA2.bssp"
#ERROR : Can't open dsspfile "1iwgA3.bssp"
#ERROR : Can't open dsspfile "1zruA3.bssp"
#ERROR : Can't open dsspfile "1zd0A1.bssp"
#ERROR : Can't open dsspfile "1iwgA7.bssp"
#ERROR : Can't open dsspfile "1iwgA8.bssp"
#ERROR : Can't open dsspfile "1iwgA4.bssp"
#ERROR : Can't open dsspfile "1iwgA6.bssp"
#ERROR : Can't open dsspfile "1iwgA2.bssp"

## Summary of PDB Search
:1044
    8e-36  51%  1iwgA7 [f.35.1.1] ACRB A:7 -- 37 A:331 -- 498
    6e-33  40%  1iwgA8 [f.35.1.1] ACRB A:513 -- 566 A:869 -- 1036
    6e-30  12%  1mwkA2 [c.55.1.1] PARM A:158 -- 320
    1e-28  14%  1e6vB2 [d.58.31.2] METHYL-COENZYME M REDUCTASE I BETA SUBUNIT B:7
    6e-25  49%  1iwgA1 [d.58.44.1] ACRB A:38 -- 134
    3e-23  32%  1iwgA4 [d.58.44.1] ACRB A:674 -- 724 A:813 -- 859
    6e-23  47%  1iwgA5 [d.225.1.1] ACRB A:182 -- 273
    8e-20  36%  1iwgA6 [d.225.1.1] ACRB A:725 -- 812
    6e-19  26%  1iwgA2 [d.58.44.1] ACRB A:135 -- 181 A:274 -- 330
    7e-18  30%  1iwgA3 [d.58.44.1] ACRB A:567 -- 673
    7e-18  10%  1zruA3 [b.163.1.2] LACTOPHAGE P2 RECEPTOR BINDING PROTEIN A:2 --
    2e-12  13%  1zd0A1 [d.329.1.1] HYPOTHETICAL PROTEIN PF0523 A:9 -- 144
    4e-19  18%  1iwgA7 [f.35.1.1] ACRB A:7 -- 37 A:331 -- 498(query 871->1024)
    7e-28  17%  1iwgA8 [f.35.1.1] ACRB A:513 -- 566 A:869 -- 1036(query 282->483)
    2e-06  18%  1iwgA4 [d.58.44.1] ACRB A:674 -- 724 A:813 -- 859(query 226->323)
    3e-10  17%  1iwgA6 [d.225.1.1] ACRB A:725 -- 812(query 183->268)
    9e-05  10%  1iwgA2 [d.58.44.1] ACRB A:135 -- 181 A:274 -- 330(query 763->853)
:1044

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxQYPAVAPPTVILYADYPGATARTVEDRVTAVLEQQMH
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1mwkA2          -----------------------------------------------------------GTTLDISQVMG
1e6vB2          ---------------------------------CVAEEVP-IEVLSPMRNEAIQSIVNDIKRTVAVD-LE
1iwgA1          -------------------------------------IAPPAVTISASYPGADAKTVQDTVTQVIEQNMN
1iwgA4          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GIPGLLYIDSSSEAGTATVTIGFRQGTDPQLAQVNVRNRVSQAEPLLPEVVRRGGVYVDQASASPFMYVS
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1mwkA2          KLSGISKIYGDSSLGVSLVTSAVKDALSLA----RTKGSSYLADDIIIHRKDNNYLKQRINDENKISIVT
1e6vB2          GIENALQNATVG------GKGMKIPGREMDVDIVDNAEAIADEIEKMIRVYQDDDTNVEPMYDGKRLLVQ
1iwgA1          GIDNLMYMSSSDSTGTVQITLTFESGTDADIAQVQVQNKLQLAMPLLPQEVQQQGVSVEKSSS-------
1iwgA4          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
1zruA3          ------------------------------------------------------------SNNDGKLYMM
1zd0A1          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LISKTGTMSETALADYAAGTVLPMLRRLPGIGKVEAYSAEYALRVWFNPDQLNAYGLTTADVEAAIRARN
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1mwkA2          E-------AMNEALRKLEQRVLNTLNEFSGYTHVMVIGGAELICDAKHTQIRDERFFKTNNSQYDLVNGM
1e6vB2          LPS----ERVKVMADPYSGTLQAGMAVVHAIIDVCEVMWDANMVKAAVFGRYPQTIDYFGGNVASMLDVP
1iwgA1          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------YAMRIWMNPNELNKFQLTPVDVITAIKAQN
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
1zruA3          LTGMD--YRTIRRKDWSS-PLNTALNVQYTNTSIIAGGRFELLNETVALKGDSVNYIHANID--LTQTAN
1zd0A1          ------------------------IRTKVGEICISKVWLDEQINKLFDRFKGDYQVVNAECADKVIFATI
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ------------------------------------------FKIDIDQEKAQALGVSINDINTTLGAAW
1iwgA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GSVTPGQLGGAPSKPGQSYQAVVRPPAPLADPEAFGRIVLRSAADGSAVLLRDVARVEMAAADYRYSSTL
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1mwkA2          ----------------------------------------------------------------------
1e6vB2          MKQ-------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA5          AQVAAGQLGGTPPVKGQQLNASIIAQTRLTSTEEFGKILLKVNQDGSRVLLRDVAKIELGG---------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------FLMVVGVINTDGTMTQEDISDYVAANM-KDAISRTSGVGDVQLFGSQYDIIAEF
1iwgA3          ----------------------------------------------------------------------
1zruA3          PVSLSAETAN--------NSNGVDINNGSGVLKVCFDIVTTS----------------------------
1zd0A1          IAIKAVKEGRSIAKTVPG-EILVRLSGNRQIKEAIKKVGAKEGENYIVTFGENASA-----LLQKILSTL
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA4          ---------------GFDFELIDQGLGHEKLTQARNQLLAEA-AKHPMLTSVRPNGLEDTSPRERY----
1iwgA6          GGSYVNDF----IDRGRVKKVYVMEAKYRMLPDDIGDWYVRA-ADGQMVPFSAFSSSR------------
1iwgA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           NGREAASMGLKLADGANVLATSRTVRDALDEAAKAFPAGVAYDISYDTAHFVQSSISRVLMTLAEATVLV
1iwgA7          -----------------------------------------LPVAQYPTPFVKISIHEVVKTLVEAIILV
1iwgA8          ----------------------------------------------------------------------
1mwkA2          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          NGQPASGLGIKLATGANALDTAAAIRAELAKMEPFFPSGLKIVYPYDT----------------------
1iwgA3          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1zd0A1          EIKE------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA8          -GWFNRMFEKSTHHYTDSVGGILRSTGRYLVLYLIIVVGMAYLFVRLPSSFLPDSGNQAPSLYAISLIVV
1iwgA4          NGLPSMEILGQAAPG----KSTGEAMELMEQLASKLPTGVGYD---------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FLILYLFLGNLRATLIPCIVVPVSLLGTVACLYAFGLSLNVITLFGVVLAIGILVDDAIVVVENVERIMR
1iwgA7          FLVMYLFLQNFRATLIPTIAVPVVLLGTFAVLAAFGFSINTLTMFGMVLAIGLLVDDAIVVVENVERVMA
1iwgA8          ----------------------------------------------------------------------
1mwkA2          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA8          FLCLAALYESWSIPFSVMLVVPLGVIGALLAATFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMD
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EEGVDAFTAASRSMREVSGXXXXXXXXXXXXXXPMAFLGSAVGVIYRHFAMTLAISIAFSLFFALSLAPA
1iwgA7          EEGLPPKEATRKSMGQIQGALVGIAMVLSAVFVPMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPA
1iwgA8          ----------------------------------------------------------------------
1mwkA2          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA8          KEGKGLIEATLDAVRMRLRPILMTSLAFILGVMPLVISTGAGSGA-QNAVGTMVTATVLAIFF-------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           MCASLLRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1iwgA7          LCATMLK---------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1mwkA2          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           EDTGELVIDVELPPGSTQAQTRETIAQLEQWMKQERLPVKTSFALLGWNSGGSGEQRASVFLSLDDWKLR
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1mwkA2          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA3          EDQGVFMTMVQLPAGATQERTQKVLNEVTHYYLTKEKNVESVFAVNGFGFAGRGQNTGIAFVSLKDWADR
1zruA3          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           GRENAADVVLARLTKGLEEWPGRGDAQLYPYNGTALPExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1mwkA2          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA3          GEENKVEAITMRATRAFSQIKD---AMVFAFNLPAIVE--------------------------------
1zruA3          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxPALDLAIDYRKAESFGVDTEAIHHALAATLGSRYIDELARDGRVRRVILQAD
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1mwkA2          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA4          ---------------------------------------------------------ATGFDFELIDQAG
1iwgA5          ----------------------------------------------------------------------
1iwgA6          ------------------PQFKIDIDQEKAQALGVSINDINTTLGAAWGGSYVNDFIDRGRVKKVYVMSE
1iwgA2          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          --------------------------------------------------------------MVVGVINT


                         .         .         *         .         .         .         .:840
query           APFRMQPEDLARLHVRNAQGQMVSLGAFATLEWGNGEATLERYNGLISVRINADVAPGTSTGTAMTRLES
1iwgA7          ----------------------------------------------------------------------
1iwgA8          -----------------------------------------WFNRMFEKSTHHYTDSVGGILRSTGRYLV
1mwkA2          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA4          LGHEKLTQARNQLLAEAAKHPMLTSVRPNGLED--TSPRLERYNGLPSMEILGQAAPGKSTGEAMELMEQ
1iwgA5          ----------------------------------------------------------------------
1iwgA6          AKYRMLPDDIGDWYVRAADGQMVPFSAFSSSRWEYG----------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1iwgA7          ----------------------------------------------------------------------
1iwgA8          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          DGTM-TQEDISDYVAANMKDAISRTSGVGDVQLFGSQDIIAEFNGQPASGLGIKLATGATAAAIRAELAK


                         +         .         .         .         .         *         .:910
query           LVRELGPDYEVRWSGRAFEQQQSGTQAPWLFALSMLFIFLCLVALYESWTLPLAVLAIVPAGLVGAASAV
1iwgA7          ----------------------------------------------------------------------
1iwgA8          LYLIIVVGMAYLFVRPSSFLPDSGNQAPSLYAISLIVVFLCLAALYESWSIPFSVMLVVPLGVIGALLAA
1mwkA2          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA4          LASKLPTGVGYDW---------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1iwgA7          ------------------------------LVEAIILVFLVMYLFLQNFRATLIPTIAVPVVLLGTFAVL
1iwgA8          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          MEPFFPSGLKIVY---------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           WLRGLPNDVYFKVGVIVIMGLAAKNAILVVEYAEQLRRNGLEXXXXXXXXXXXXXXPVVMTSLAFILGVV
1iwgA7          ----------------------------------------------------------------------
1iwgA8          TFRGLTNDVYFQVGLLTTIGLSAKNAILIVEFAKDLMDKEGKGLIEATLDAVRMRLPILMTSLAFILGVM
1mwkA2          ----------------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------------
1zruA3          ----------------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------------
1iwgA7          AAFGFSINTLTMFGMVLAIGLLVDDAIVVVEVERVMAEEGLPPKEATRKSMGQIQGALVGIAMVLSAVFV
1iwgA8          ----------------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           PLAISTGPGAGAQRAVGTGVLGGMLGATILGTLVIPLLYAWIARxxxxxxxxxxxxxxxxxxxx
1iwgA7          ----------------------------------------------------------------
1iwgA8          PLVISTGAGSGAQNAVGTGVMGGMVTATVLAIFFVPVFFVVVRR--------------------
1mwkA2          ----------------------------------------------------------------
1e6vB2          ----------------------------------------------------------------
1iwgA1          ----------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------
1iwgA5          ----------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------
1iwgA3          ----------------------------------------------------------------
1zruA3          ----------------------------------------------------------------
1zd0A1          ----------------------------------------------------------------
1iwgA7          PMAFFGGSTGAIYRQFSITIVSAMALSVLVALILTPALCATMLK--------------------
1iwgA8          ----------------------------------------------------------------
1iwgA4          ----------------------------------------------------------------
1iwgA6          ----------------------------------------------------------------
1iwgA2          ----------------------------------------------------------------