[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF08055.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ff3A.bssp"
#ERROR : Can't open dsspfile "1nwaA.bssp"
#ERROR : Can't open dsspfile "1aw0A.bssp"
#ERROR : Can't open dsspfile "2qifA1.bssp"
#ERROR : Can't open dsspfile "1osdA.bssp"
#ERROR : Can't open dsspfile "1jwwA.bssp"

## Summary of PDB Search
:243
    8e-59  42%  1ff3A  [d.58.28.1] PEPTIDE METHIONINE SULFOXIDE REDUCTASE
    6e-51  42%  1nwaA  [d.58.28.1] PEPTIDE METHIONINE SULFOXIDE REDUCTASE MSRA
    1e-08  23%  1aw0A  [d.58.17.1] MENKES COPPER-TRANSPORTING ATPASE
    3e-08  16%  2qifA1 [d.58.17.1] COPPER CHAPERONE COPZ A:1 -- 69
    8e-08  23%  1osdA  [d.58.17.1] HYPOTHETICAL PROTEIN MERP
    4e-04  25%  1jwwA  [d.58.17.1] POTENTIAL COPPER-TRANSPORTING ATPASE
:243

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxISAEAAVKIPAPAVDEKAGTSHTETAVFAGGCFWG
1ff3A           -----------------------------------VSPADALPMPVATLHAVNGHSGMEIAIFAMGXFWG
1nwaA           ------------------------------------------------------MTSNQKAILAGGCFWG
1aw0A           ---------------------------------------------------------TQETVINNSCVQS
2qifA1          ----------------------------------------------------------EQKTLQQHCVKA
1osdA           ---------------------------------------------------------TQTVTLSSACPIT
1jwwA           ---------------------------------------------------------TEKAEFDAACANR


                         .         .         *         .         .         .         .:140
query           VQGVFQHVRGVTRVTSGYSGGSASNAQYEMVGTGMTGHAESVEIRYDPTQISYGKLLQIFFSVAHNPTQL
1ff3A           VERLFWQLPGVYSTAAGYTGGYTPNPTYREVCSGDTGHAEAVRIVYDPSVISYEQLLQVFWEN-HDPAQG
1nwaA           LQDLIRNQPGVVSTRVGYSGGNIPNATYRNHG----THAEAVEIIFDPTVTDYRTLLEFFFQI-HDPTTK
1aw0A           IEGVISKKPGVKSIRVSLANS-------------------NGTVEYDPLLTSPETLRG------------
2qifA1          VETSVGELDGVSAVHVNLEAG-------------------KVDVSFDADKVSVKDIADAIEDQGYDVAK-
1osdA           VKKAISKVEGVSKVDVTFETR-------------------QAVVTFDDAKTSVQKLTK------------
1jwwA           IEKRLNKIEGVANAPVNFA-------------------LETVTVEYNPKEASVSDLKE------------


                         +         .         .         .         .         *         .:210
query           NYQGPDHGTQYRSAIFPRSPVQRSIAEAYITQLDTSKAYRAPIVTRVEDYKGFFPAENYHQDFLVKNPSY
1ff3A           MRQGNDHGTQYRSAIYPLTPEQDAAARASLERFQAAADDDRHITTEIANATPFYYAEDDHQQYLHKNP--
1nwaA           DRQGNDRGTSYRSAIFYFDEQQKRIALDTIADVEASGLWPGKVVTEVSPAGDFWEAEPEHQDYLQRYPNG
1aw0A           ----------------------------------------------------------------------
2qifA1          ----------------------------------------------------------------------
1osdA           ----------------------------------------------------------------------
1jwwA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PYxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1ff3A           ---------------------------------
1nwaA           YT-------------------------------
1aw0A           ---------------------------------
2qifA1          ---------------------------------
1osdA           ---------------------------------
1jwwA           ---------------------------------