[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF08099.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gt8A2.bssp"
#ERROR : Can't open dsspfile "1d3gA.bssp"
#ERROR : Can't open dsspfile "1dorA.bssp"
#ERROR : Can't open dsspfile "1ep1A.bssp"
#ERROR : Can't open dsspfile "1djnA1.bssp"
#ERROR : Can't open dsspfile "1bhwA.bssp"
#ERROR : Can't open dsspfile "1ps9A1.bssp"
#ERROR : Can't open dsspfile "2a4aA1.bssp"
#ERROR : Can't open dsspfile "1z41A1.bssp"
#ERROR : Can't open dsspfile "1al7A.bssp"
#ERROR : Can't open dsspfile "1bwkA.bssp"
#ERROR : Can't open dsspfile "1jcjA.bssp"
#ERROR : Can't open dsspfile "1ea0A2.bssp"
#ERROR : Can't open dsspfile "1vhnA.bssp"
#ERROR : Can't open dsspfile "1znnA1.bssp"
#ERROR : Can't open dsspfile "1hg3A.bssp"
#ERROR : Can't open dsspfile "1geqA.bssp"
#ERROR : Can't open dsspfile "1j2wA.bssp"
#ERROR : Can't open dsspfile "1efzA.bssp"
#ERROR : Can't open dsspfile "1gpwA.bssp"
#ERROR : Can't open dsspfile "1tygA.bssp"
#ERROR : Can't open dsspfile "1dqwA.bssp"
#ERROR : Can't open dsspfile "1m1bA.bssp"

## Summary of PDB Search
:358
    1e-66  22%  1gt8A2 [c.1.4.1] DIHYDROPYRIMIDINE DEHYDROGENASE A:533 -- 844
    1e-44  38%  1d3gA  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE
    4e-31  22%  1dorA  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE A
    9e-29  24%  1ep1A  [c.1.4.1] DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
    4e-27  11%  1djnA1 [c.1.4.1] TRIMETHYLAMINE DEHYDROGENASE A:1 -- 340
    4e-23  10%  1bhwA  [c.1.15.3] XYLOSE ISOMERASE
    2e-21  14%  1ps9A1 [c.1.4.1] 2,4-DIENOYL-COA REDUCTASE A:1 -- 330
    4e-21   9%  2a4aA1 [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE A:3 -- 258
    9e-19  15%  1z41A1 [c.1.4.1] PROBABLE NADH-DEPENDENT FLAVIN OXIDOREDUCTASE A:2
    2e-16  14%  1al7A  [c.1.4.1] GLYCOLATE OXIDASE
    5e-16  10%  1bwkA  [c.1.4.1] PROTEIN (NADPH DEHYDROGENASE 1)
    3e-15  13%  1jcjA  [c.1.10.1] DEOXYRIBOSE-PHOSPHATE ALDOLASE
    6e-14  15%  1ea0A2 [c.1.4.1] GLUTAMATE SYNTHASE [NADPH] LARGE CHAIN A:423 --
    1e-13  20%  1vhnA  [c.1.4.1] PUTATIVE FLAVIN OXIDOREDUCATASE
    2e-13  11%  1znnA1 [c.1.2.6] PLP SYNTHASE A:18 -- 271
    4e-13  12%  1hg3A  [c.1.1.1] TRIOSEPHOSPHATE ISOMERASE
    2e-11  14%  1geqA  [c.1.2.4] TRYPTOPHAN SYNTHASE ALPHA-SUBUNIT
    7e-10  21%  1j2wA  [c.1.10.1] ALDOLASE PROTEIN
    1e-08  13%  1efzA  [c.1.20.1] TRNA-GUANINE TRANSGLYCOSYLASE
    4e-05  24%  1gpwA  [c.1.2.1] HISF PROTEIN
    2e-04  32%  1tygA  [c.1.31.1] THIAZOLE BIOSYNTHESIS PROTEIN THIG
    9e-04   9%  1dqwA  [c.1.2.3] OROTIDINE 5'-PHOSPHATE DECARBOXYLASE
    0.001  10%  1m1bA  [c.1.12.7] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
:358

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxALYPLLRPALFSMDAEDAHHFTLNNLMRAKRMGLAGCIGNSIADDPRTVMGVR
1gt8A2          ----------------------------------------------------------------EMAGLK
1d3gA           -----------------YAEHLMPTLQGLLDPESAHRLAVR-FTSLGLL-----PFQDSDMLEVRVLGHK
1dorA           --------------------------------------------------------------NTTFANAK
1ep1A           ------------------------------------------------------------ENNRLLPGLD
1djnA1          -------------------------------------------------------------EPIQIGPKT
1bhwA           ------------------------------------------------------------ATREDKFSFQ
1ps9A1          -------------------------------------------------------------APLDLGFTT
2a4aA1          ----------------------------------------------------------------------
1z41A1          -------------------------------------------------------------TPITIKDXT
1al7A           -----------------------------AEDQWTLAENRNAFSRILFRPRI-LIDVTNIDMTTTILGFK
1bwkA           ----------------------------------------------------------------------
1jcjA           ----------------------------------------------------------------------
1ea0A2          ----------------------------------------------------------------------
1vhnA           ----------------------------------------------------------------------
1znnA1          ----------------------------------------------------------------------
1hg3A           ----------------------------------------------------------------------
1geqA           ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1efzA           ---------------------------------------------------------------------V
1gpwA           ----------------------------------------------------------------------
1tygA           ----------------------------------------------------------------------
1dqwA           ----------------------------------------------------------------------
1m1bA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           FPNPVGLAAGLDKDGAYIDGLAAFGFGFIEVGTVTPRAQPGNPRPRMFRLPQADALINRMGFNNGGVDAF
1gt8A2          FINPFGLASAAPTTSSSIRRAFEAGWGFALTKTFSDKDIVTNVSPRIVRGTTSGPMYGPGQSSFLNIELI
1d3gA           FRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVV
1dorA           FANPFMNASGHCMTIEDLEELKASQAGAYITKSSTLEKREGNPLPRYVDLE--LGSINSMGLPNLGFDYY
1ep1A           LKNPIIPASGCFGFGEEYAKYDLNKLGSIMVKATTLHPRFGNPTPRVAETAS--GMLNAIGLQNPGLEVI
1djnA1          LRNRFYQVPHPGFQSAHRSVKAEGGWAALNTEYCSINPESDDTHRLSARIWDEGDVRNLKAMTDEVHKYG
1bhwA           ARDAFGDATRTALDVEAVHKLAEIGAYGITFHDDDLVPFGSDAQTRDGIIAGFKKALDETGLIVPMVTTN
1ps9A1          LKNRVLMGSMAERLAAFYAERARHGVALIVSGGIAPDLT-GVGMEGGAMLNDTEAVHQEGGKIALQILHT
2a4aA1          -------------------------ICLTDHTFLDENGT-EDDIRELCNESVKTCPFAAAVCVYPKFVKF
1z41A1          LKNRIVXSPSHEKDGAHYISRAIGQVGLIIVEASAVNPQDQDLGIKLTEQVKEQGSKIGIQLAHAGRKAE
1al7A           ISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVVA
1bwkA           ---------------------EKKSFVWVQLWVLGWAAFPDNLARDGLRYDSASDNVFMDAEQEAKAKKA
1jcjA           ---------------------------------------------KVIALCH-QAKTPVGNTAAICIYPR
1ea0A2          ----------------------TLNVAMNRIGAKSDSGEGGEDPARFRPDKNGDNAIKQVASGRFGVTAE
1vhnA           ----------------------------------------------------------------------
1znnA1          ----------------------------------------------------------------------
1hg3A           ----------------------------------------------------------------------
1geqA           ----------------------------------------------------------------------
1j2wA           ----------------------------------------------------------------------
1efzA           IRTPAFMPVGTAATALKPETVRATGADIILGNTYHLMLRPGAERIAKLG-----GLHSFMGWDRPILTDA
1gpwA           ----------------------------------------------------------------------
1tygA           ----------------------------------------------------------------------
1dqwA           ----------------------------------------------------------------------
1m1bA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IRNVQASRWKAEGGVLGLNIGKNADTPIERAADDYLYCLERVYPHASYVTVNISSPNTKNLRQLQGASEL
1gt8A2          SEKT-AAYWCQSVTELKADFPDNASIMCSYNKNDWMELSRKAESGADALELNLSCPHGMGEMGLACGQDP
1d3gA           EHRLRARQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLGKAELRRLL
1dorA           LDYVLKNQKENAQE----GPIFFSIAGMSAAENIAMLKKIQESDFSGITELNLSCPNVPGKPQLAYDFEA
1ep1A           MTEKLPWLNENFPEL---PIIANVAGS---EEADYVAVCAKIAANVKAIELNISCPNVKHGGQAFGTDPE
1djnA1          GVELWYGGAHAPNMESRATPRGPSQYAIAQVQQFYVDAAKRVYGAHSYLPLQFLNPYYNKRTDKYGGS-L
1bhwA           LFTHPVFKDG--------GFTSNDRSVRRYAIRKVLRQMDLGAELAKTLVLWGGREGAEYDSAKDVSAAL
1ps9A1          GRYLQAPINRFVPHELSHEEILQLIDNFARCAQEAGYDGVEVMGSEGYLINEFLTLRTNQRSDQWGGDYR
2a4aA1          INEKIKQEINPFKPKIACVINFPYGTDSMEKVLNDTEKALDDGADEIDLVINYKKIIENTDEGLKEATKL
1z41A1          LEGFAPSAIAFDEQSATPVEXSAEK--VKETVQEFKQAAARAKEAHGYLIHEFLSPLSNHRTDEYGGSRY
1al7A           QLVRRAERAGFKAIAL------TVDTPRLGRREADIKNRFVLPPFLTLKNFE------------------
1bwkA           NNPQHSLTKD-----EIKQYIKEYVQAAKNSIAAGADGVE-INSANGYLLNQFLDPHSNTRTDEYGGS-I
1jcjA           FIPI-ARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGN------
1ea0A2          LNQCRELEIKVAQGA---KPGEGGQLPGFKVTEMI--------ARLRHSTPGVMLISPPPHHDIYSIEDL
1vhnA           --------PQPHERNVAVQIFGSEPNELSEAA-------RILSEKYKWIDLNAGCPVRKVVKEGAGGA--
1znnA1          -------------------VMNAVSIPVMARIGHYVEARVLEALGVDYIDESEVLTPADEEFHIDKRQFT
1hg3A           -------------------IAINFKTYIEATGKRALEIAKAAEKVYKETGVTIVVAESVEIPVFAQHIDP
1geqA           --------------------------------QSTLNFLLALDEYAGAIELGIPFSDPIHYRALKNGFKL
1j2wA           ----------------------------------------------------------------------
1efzA           GGYQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPS-RAASSM
1gpwA           ----------------------------------------------------------------------
1tygA           ----------------------------------------------------------------------
1dqwA           ----------------------------------------------------------------------
1m1bA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DSLLSTLKAAQQRLADQHKRYVPVALKIAPDLDDDQVRNIGDALVRHKIDGVIATNTTISRDAVKGLPHA
1gt8A2          ELVRNICRWVRQAVQ------IPFFAKLTPNVTD--IVSIARAAKEGGADGVTATNTVSGLMGLKGAGKR
1d3gA           TKVLQERDGLR------RVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGALR
1dorA           --TEKLLKEVFT------FFTKPLGVKLPPYFDLVHFDIMAEILNQFPLTYVNSVNSIGNGLFIDPEAEK
1ep1A           AALVKACKAVSK---------VPLYVKLSPNVTD--IVPIAKAVEAAGADGLTMINTLMGVRFDLKTRLA
1djnA1          ENRARFWLETLEKVKHAVGSDCAIATRFGVDTVYGPGQIEAEVDGQKFVEMADSLVDMWDITIG-DIAEW
1bhwA           DRYREALNLLAQYSEDRGYGLRPKPNEPRGDILLPTAGHAIAFVQELERPELFGINPETGNEQMSNLNFT
1ps9A1          NRMVEVVRAVRERVGNDFIIIYSMLDLVEDGGTFAETVELAQAIEAAGATIINTG----------IGWHE
2a4aA1          --TQSVKKLL-------TNKILKVIIEVGELKTEDLIIKTTLAVLNGNADFIKTSTGKVQIN--------
1z41A1          RFLREIIDEVKQVWDGPLFVRVSASDYTDKGLDIADHIGFAKWXKEQGVDLIDCSSGAL-----------
1al7A           --------------GIDLGLSSYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEDARLAVQHGAAGI
1bwkA           ENRARFTLEVVDALVEAIGHE-KVGLRLSPYGVFNSMSGGAETGQYAYVAGELEKRAKAGKRLAFVHLVE
1jcjA           EQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGK------------
1ea0A2          AQLIYDLKQINPD--------AKVTVKLVSRSGIGT---IAAGVAKANADIILISGNSGGTGASP-----
1vhnA           --LLKDLRHFRYIVRELRKSVGKFSVKTRLGWEKNEVEEIYRILVEEGVDEVFIHTRTV-----------
1znnA1          VPFVCGCRDLGE--AARRIAEGASMLRTKGEPGTGNIVEAVRHMRKVNAQIRKVVNMSE-----------
1hg3A           IKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMTMVCSNNALNPDYVAVEPPE
1geqA           REAFWIVKEFRRHYRAGVRNFLAEAKALVVDLPVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDM
1j2wA           ----------------------GRAKAGDLDYLEAEVRAVREAVPQAVLKVILETGYF-SPEEIARLAEA
1efzA           ERSMRWAKRSRDDSRKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAV----------------
1gpwA           ----------------------------------------------------------------------
1tygA           ----------------------------------------------------------------------
1dqwA           -----------------------------IVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGEYTKGTK
1m1bA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           EEAGGLSGRPVFEASTRVVRALREVIGDALPIIGVGGIFSGADARAKIDAGAQLVQVYSGLIYRGPTLVR
1gt8A2          TTYGGVSGTAIRPIALRAVTTIARAL-PGFPILATGGIDSAESGLQFLHSGASVLQVCSAVQNQDFTVIQ
1d3gA           SETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVG
1dorA           DGFGGIGGAYIKPTALANVRAFYTRLKPEIQIIGTGGIETGQDAFEHLLCGATMLQIGTALHKEGPAIFD
1ep1A           NITGGLSGPAIKPVALKLIHQVAQDV--DIPIIGMGGVANAQDVLEMYMAGASAVAVGTA-NFADPFVCP
1djnA1          GEDAGPSRFYQQGHTIPWVKLVKQVSK--KPVLGVGRYTDPEKMIEIVTKGYADIIGCARPSIADPFLPQ
1bhwA           QGIAQALWHK------------------------------------------------------------
1ps9A1          ARIPTIATPVPRGAFSWVTRKLKGHVS--LPLVTTNRINDPQVADDILSRGDADMVSMARPFLADAELLS
2a4aA1          ---ATPSSVEYIIKAIKEYIKNNPEKNNKIGLKVSGGISDLNTASHYILLARRFLSDNFRIG--SSSLVI
1z41A1          VHADINVFPGYQV---SFAEKIREQADX--ATGAVGXITDGSXAEEILQNGRADLIFIGRELLRDPFFAR
1al7A           VSNHGARQLDYVPATIMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSGEAGVK
1bwkA           PRVTNPFLTEGEGEYEGSNDFVYSIWK--GPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVD
1jcjA           ----VAVNATPESARIMMEVIRDMGVEKTVGFLPAGGVRTAEDAQKYLAIADELFGADWADAR----HYR
1ea0A2          QTSIKFAGLPWEMGLSEVHQVLTLNLRHRVRLRTDGGLKTGRDIVIAAMLGAEEFGIGTASLAMGCIMVR
1vhnA           --VQSFTGRAEWKALSV--------LEKRIPTFVSGDIFTPEDAKRALESGCDGLLVARGAIGR-PWIFK
1znnA1          --DELVAEAKQLGAPVEVLREIKRLGRLPVVNFAAGGVTTPADAALMMHLGADGVFVGSG-IFKSENPEK
1hg3A           LIGTGIPVSKAKPEVITNTVELVKKVNPEVKVLCGAGISTGEDVKKAIELGTVGVLLASG-VTKAKDPEK
1geqA           TTGYLVSLYEIPKTAYDLLRRAKRICR--NKVAVGFGVSKREHVVSLLKEGANGVVVGSALVKIIGEKGR
1j2wA           AIRGGADFLKTSTGFGPDVALLVRVAQGRAQVKAAGGIRDRETALRMLKAGASRLGTSSGVALVA-----
1efzA           ---GGLAVGEGQDEMFRVLDFSVPMLPDDKPHY-LMGVGKPDDIVGAVERGIDMFDCVLPTRSGGQAFTW
1gpwA           ---ASVEKRKTM---LELVEKVAEQID--IPFTVGGGIHDFETASELILRGADKVSINTAAV-ENPSLIT
1tygA           --------------------NLSFIIEQAVPVIVDAGIGSPKDAAYAMELGADGVLLNTAV---------
1dqwA           DFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDDVVSTGSDIIIVGRG-LFAKGRDAK
1m1bA           -----------------------------GPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQ


                         .         .         .         .         *         .         .:420
query           ECASALRR
1gt8A2          DYCTGLK-
1d3gA           KVKRELEA
1dorA           RIIKELEE
1ep1A           KIIDKLPE
1djnA1          KVEQGR--
1bhwA           --------
1ps9A1          KAQSGR--
2a4aA1          KLRKVI--
1z41A1          TAAKQL--
1al7A           KVLQMMRD
1bwkA           RLEKGLP-
1jcjA           FGASSL--
1ea0A2          QC------
1vhnA           QIKDFLR-
1znnA1          YARAIVEA
1hg3A           AIWDLV--
1geqA           EATEFLKK
1j2wA           --------
1efzA           DGPINIRN
1gpwA           QIAQT---
1tygA           --------
1dqwA           VEGERYR-
1m1bA           QTTKQIYD