[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF08451.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1s66L.bssp"
#ERROR : Can't open dsspfile "1ll8A.bssp"
#ERROR : Can't open dsspfile "1d06A.bssp"
#ERROR : Can't open dsspfile "2axtC1.bssp"
#ERROR : Can't open dsspfile "1oj5A.bssp"
#ERROR : Can't open dsspfile "1p97A.bssp"
#ERROR : Can't open dsspfile "1d7eA.bssp"
#ERROR : Can't open dsspfile "1g28A.bssp"
#ERROR : Can't open dsspfile "3c2wA3.bssp"
#ERROR : Can't open dsspfile "2fi0A1.bssp"
#ERROR : Can't open dsspfile "1bywA.bssp"
#ERROR : Can't open dsspfile "2ookA1.bssp"
#ERROR : Can't open dsspfile "2veaA3.bssp"
#ERROR : Can't open dsspfile "2oolA2.bssp"
#ERROR : Can't open dsspfile "1tfoA1.bssp"
#ERROR : Can't open dsspfile "1ztuA2.bssp"

## Summary of PDB Search
:139
    2e-23  26%  1s66L  [d.110.3.2] HYPOTHETICAL PROTEIN YDDU
    2e-17  15%  1ll8A  [d.110.3.5] PAS KINASE
    3e-16  30%  1d06A  [d.110.3.2] NITROGEN FIXATION REGULATORY PROTEIN FIXL
    7e-16   7%  2axtC1 [f.55.1.1] PHOTOSYSTEM II CP43 PROTEIN C:27 -- 473
    3e-15  17%  1oj5A  [d.110.3.8] STEROID RECEPTOR COACTIVATOR 1A
    5e-15  18%  1p97A  [d.110.3.7] ENDOTHELIAL PAS DOMAIN PROTEIN 1
    1e-13  19%  1d7eA  [d.110.3.1] PHOTOACTIVE YELLOW PROTEIN
    4e-13  18%  1g28A  [d.110.3.6] PHY3 PROTEIN
    2e-12  10%  3c2wA3 [d.110.3.9] BACTERIOPHYTOCHROME A:5 -- 117
    3e-12   6%  2fi0A1 [a.248.1.1] CONSERVED DOMAIN PROTEIN A:3 -- 81
    5e-12  18%  1bywA  [d.110.3.6] PROTEIN (HUMAN ERG POTASSIUM CHANNEL)
    4e-11   7%  2ookA1 [c.13.2.2] HYPOTHETICAL PROTEIN A:2 -- 126
    1e-10  12%  2veaA3 [d.110.3.9] PHYTOCHROME-LIKE PROTEIN CPH1 A:4 -- 130
    1e-10  13%  2oolA2 [d.110.3.9] SENSOR PROTEIN A:26 -- 139
    1e-10   9%  1tfoA1 [d.243.1.1] COLICIN D A:595 -- 697
    6e-08  29%  1ztuA2 [d.110.3.9] BACTERIOPHYTOCHROME A:5 -- 130
:139

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxAQILEQLADALIFADTDGRITGWNHAAAELFGYGPDEALGQSLDLIIPERLQAAHWKGFQAA
1s66L           ---------PALEQNMMGAVLINENDEVMFFNPAAEKLWGYKREEVIGNNIDMLIPRDLRPAHPEYIRHN
1ll8A           --------GAMDPEFNKAIFTVDATTEILVANDKACGLLGYSSQDLIGQKLTQFFLRSDSDVVEALSEEH
1d06A           ---------SILDTVPDATVVSATDGTIVSFNAAAVRQFGYAEEEVIGQNLRILMPEPYRHEHDGYLQRY
2axtC1          ----------AQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDNDIQPWQERRAAEY
1oj5A           --------------VESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKYAFFQPQGREPSYARQLFQE
1p97A           ------------MDSKTFLSRHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNL
1d7eA           ---------GQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKQVIGKNFKDVAPCTDSPEFYGKFKEG
1g28A           --------------ITDP---RLPDNPIIFASDRFLELTEYTREEVLGNNCRFLQGRGTDRKAVQLIRDA
3c2wA3          ----------GAIQPHGALVTLRADGMVLAASENIQALLGFVASP-GSYLTQEQVGPEVLRMLEEGLTGN
2fi0A1          --------------PVAEVVDKHPEVLEILVELGFKPLANPLMRNTVGRKVSLKQGSKLAGTPMDKIVRT
1bywA           ---------------SRKFIIANANCAVIYCNDGFCELCGYSRAEVMQRPC----TCDFLHGPCTQRRAA
2ookA1          ----------------VFFVTLKAIGTLTHEDYLVITXLEGALSQVDQPKVLFLDATELDGWDLRAAWDD
2veaA3          ---------HLIQPHGLVVVLQEPDLTISQISANCTGILGRSPEDLLGRTLGEVFDSFLTAGQISSLNPS
2oolA2          ---------GAIQPHGYLFVVSETDLRIASVSANVEDLLRQPPASLLNVPIAHYLTAASAARLTHALHGA
1tfoA1          ------------------------------------DSGRFSRKQLDKKYDTKKNRETLTKF-RDAIEEH
1ztuA2          ------------------LTADGHSGEVLQMSLNAATFLGQEPTVLRGQTLAALLPEALQAALPPGCPDA


                         .         .         *         .         .         .         .:140
query           IDTGKTRLSGKPTLTKAIHKDGRKLFVEMTFALISDANGNVIGSVAVARDVTDKVERERAQSAxxxxxx
1s66L           REGGKARVEGMSRELQLEKKDGSKIWTRFALSKVSAEGK--VYYLALVRDAS-----------------
1ll8A           MEADGHAAVVFGTVVDIISRSGEKIPVSVWMKRMRQERRLCCV---VVLEPVER---------------
1d06A           MATGEKRIIGIDRVVSGQRKDGSTFPMKLAVGEMRS--GGERFFTGFIRDLT-----------------
2axtC1          MTHAPLG--SLNSVGGVATEINSVNFVSPRSWLATSHFVLAFF--FLVGHLWH-AGRARAAAA------
1oj5A           VMTRGTA---SSPSYRFILNDGTMLSAHTRCKLCYPMQPFIMGIHIIDRE-------------------
1p97A           CTKGQVV----SGQYRMLAKHGGYVWLETQGTVIYNPRNLPQCIMCVNYVLSEIEK-------------
1d7eA           VASGNLN----TMFEYTFDYQMTPTKVKVH---MKKALSYWVFVKRV----------------------
1g28A           VKEQRDV----TVQVLNYTKGGRAFWNLFHLQVMRDENGDVQYFIGVQQEM------------------
3c2wA3          GPWSNSVETR---------IGEHLFDVIGH-----SYKEVFYLEFEIRTADT-----------------
2fi0A1          LEANGYE--------------------------------------------------------------
1bywA           AQIAQALLGAEEVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK---------------
2ookA1          LKLGLKHK----SEFERVAILGNKDWQEWA--AKIGSWFIAGEIKYFEDEDDALKW-------------
2veaA3          KLWARVMDFVIFDGVFHRNSDGLLVCE------------------------------------------
2oolA2          INPIRLDVVTPRAFNGILHRHDSIVILE-----------------------------------------
1tfoA1          LSDKDTVEKGTYRR---EKGSKVYFNPNTMNVVIIKSNGEFLSGWKINPDADNGRIYLE----------
1ztuA2          LQYRATL-DWPGHLSLTVHRVGELLILE-----------------------------------------