[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF08678.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1r1uA.bssp"
#ERROR : Can't open dsspfile "1ulyA.bssp"
#ERROR : Can't open dsspfile "1fnnA1.bssp"
#ERROR : Can't open dsspfile "1r1tA.bssp"
#ERROR : Can't open dsspfile "1cgpA1.bssp"
#ERROR : Can't open dsspfile "2cohA1.bssp"
#ERROR : Can't open dsspfile "1z05A1.bssp"
#ERROR : Can't open dsspfile "2h6bA1.bssp"
#ERROR : Can't open dsspfile "2gauA1.bssp"
#ERROR : Can't open dsspfile "2jn6A1.bssp"
#ERROR : Can't open dsspfile "2p4wA1.bssp"
#ERROR : Can't open dsspfile "2b0lA1.bssp"
#ERROR : Can't open dsspfile "2hoeA1.bssp"
#ERROR : Can't open dsspfile "1ft9A1.bssp"
#ERROR : Can't open dsspfile "2hs5A1.bssp"
#ERROR : Can't open dsspfile "2dk5A1.bssp"
#ERROR : Can't open dsspfile "1lvaA3.bssp"
#ERROR : Can't open dsspfile "1z6rA1.bssp"
#ERROR : Can't open dsspfile "1wi9A.bssp"
#ERROR : Can't open dsspfile "1u2wA1.bssp"
#ERROR : Can't open dsspfile "1q1hA.bssp"
#ERROR : Can't open dsspfile "1mzbA.bssp"
#ERROR : Can't open dsspfile "1oyiA.bssp"
#ERROR : Can't open dsspfile "1sfuA.bssp"
#ERROR : Can't open dsspfile "1biaA1.bssp"
#ERROR : Can't open dsspfile "1qbjA.bssp"
#ERROR : Can't open dsspfile "2co5A1.bssp"
#ERROR : Can't open dsspfile "2htjA1.bssp"
#ERROR : Can't open dsspfile "2eshA1.bssp"
#ERROR : Can't open dsspfile "1k78A1.bssp"
#ERROR : Can't open dsspfile "2fnaA1.bssp"
#ERROR : Can't open dsspfile "2ethA1.bssp"
#ERROR : Can't open dsspfile "1mkmA1.bssp"
#ERROR : Can't open dsspfile "1ub9A.bssp"
#ERROR : Can't open dsspfile "2a61A1.bssp"
#ERROR : Can't open dsspfile "1zybA1.bssp"
#ERROR : Can't open dsspfile "2f2eA1.bssp"
#ERROR : Can't open dsspfile "2fswA1.bssp"
#ERROR : Can't open dsspfile "1xcbA1.bssp"
#ERROR : Can't open dsspfile "1v4rA1.bssp"
#ERROR : Can't open dsspfile "1y0uA.bssp"
#ERROR : Can't open dsspfile "2oa4A1.bssp"
#ERROR : Can't open dsspfile "1fp2A1.bssp"
#ERROR : Can't open dsspfile "2g9wA1.bssp"
#ERROR : Can't open dsspfile "2fxaA1.bssp"
#ERROR : Can't open dsspfile "3ctaA1.bssp"
#ERROR : Can't open dsspfile "2obpA1.bssp"
#ERROR : Can't open dsspfile "1ku9A.bssp"
#ERROR : Can't open dsspfile "2d1hA1.bssp"
#ERROR : Can't open dsspfile "2fbiA1.bssp"
#ERROR : Can't open dsspfile "1p6rA.bssp"
#ERROR : Can't open dsspfile "1dpuA.bssp"
#ERROR : Can't open dsspfile "1xmkA1.bssp"
#ERROR : Can't open dsspfile "1tqiA1.bssp"
#ERROR : Can't open dsspfile "1lvaA4.bssp"
#ERROR : Can't open dsspfile "2p8tA1.bssp"
#ERROR : Can't open dsspfile "1yg2A.bssp"
#ERROR : Can't open dsspfile "1p4xA2.bssp"
#ERROR : Can't open dsspfile "1i1gA1.bssp"
#ERROR : Can't open dsspfile "1sfxA.bssp"
#ERROR : Can't open dsspfile "1jhfA1.bssp"
#ERROR : Can't open dsspfile "1aoyA.bssp"
#ERROR : Can't open dsspfile "1xd7A.bssp"
#ERROR : Can't open dsspfile "1xn7A.bssp"
#ERROR : Can't open dsspfile "1on1A1.bssp"
#ERROR : Can't open dsspfile "1p4xA1.bssp"
#ERROR : Can't open dsspfile "1xmaA.bssp"
#ERROR : Can't open dsspfile "1e2xA1.bssp"

## Summary of PDB Search
:121
    7e-15  20%  1r1uA  [a.4.5.5] REPRESSOR PROTEIN
    2e-12  14%  1ulyA  [a.4.5.58] HYPOTHETICAL PROTEIN PH1932
    2e-12  15%  1fnnA1 [a.4.5.11] CELL DIVISION CONTROL PROTEIN 6 A:277 -- 388
    6e-12  32%  1r1tA  [a.4.5.5] TRANSCRIPTIONAL REPRESSOR SMTB
    5e-11  18%  1cgpA1 [a.4.5.4] PROTEIN (CATABOLITE GENE ACTIVATOR PROTEIN (CAP)
    3e-10  18%  2cohA1 [a.4.5.4] TRANSCRIPTIONAL REGULATOR A:118 -- 199
    3e-10  13%  1z05A1 [a.4.5.63] TRANSCRIPTIONAL REGULATOR, ROK FAMILY A:10 --
    9e-10  18%  2h6bA1 [a.4.5.4] CHLOROPHENOL REDUCTION GENE K A:148 -- 229
    1e-09  15%  2gauA1 [a.4.5.4] TRANSCRIPTIONAL REGULATOR, CRP/FNR FAMILY A:152
    1e-09  11%  2jn6A1 [a.4.1.19] PROTEIN CGL2762 A:1 -- 89
    2e-09  26%  2p4wA1 [a.4.5.64] TRANSCRIPTIONAL REGULATORY PROTEIN ARSR FAMILY
    2e-09  14%  2b0lA1 [a.4.5.66] GTP-SENSING TRANSCRIPTIONAL PLEIOTROPIC A:167
    2e-09  25%  2hoeA1 [a.4.5.63] N-ACETYLGLUCOSAMINE KINASE A:10 -- 71
    7e-09  15%  1ft9A1 [a.4.5.4] CARBON MONOXIDE OXIDATION SYSTEM TRANSCRIPTION
    1e-08  22%  2hs5A1 [a.4.5.6] PUTATIVE TRANSCRIPTIONAL REGULATOR GNTR A:25 --
    2e-08  10%  2dk5A1 [a.4.5.85] DNA-DIRECTED RNA POLYMERASE III 39 KDA A:8 --
    2e-08  14%  1lvaA3 [a.4.5.35] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR A:511
    2e-08  17%  1z6rA1 [a.4.5.63] MLC PROTEIN A:12 -- 81
    5e-08  11%  1wi9A  [a.4.5.47] PROTEIN C20ORF116 HOMOLOG
    6e-08  22%  1u2wA1 [a.4.5.5] CADMIUM EFFLUX SYSTEM ACCESSORY PROTEIN A:12 --
    7e-08  22%  1q1hA  [a.4.5.41] TRANSCRIPTION FACTOR E
    1e-07  20%  1mzbA  [a.4.5.42] FERRIC UPTAKE REGULATION PROTEIN
    2e-07  19%  1oyiA  [a.4.5.19] DOUBLE-STRANDED RNA-BINDING PROTEIN
    2e-07  12%  1sfuA  [a.4.5.19] 34L PROTEIN
    2e-07  28%  1biaA1 [a.4.5.1] BIRA BIFUNCTIONAL PROTEIN A:1 -- 63
    3e-07  14%  1qbjA  [a.4.5.19] PROTEIN (DOUBLE-STRANDED RNA SPECIFIC ADENOSINE
    4e-07  14%  2co5A1 [a.4.5.48] VIRAL PROTEIN F93 A:5 -- 93
    7e-07  25%  2htjA1 [a.4.5.73] P FIMBRIAL REGULATORY PROTEIN KS71A A:1 -- 73
    8e-07  14%  2eshA1 [a.4.5.61] CONSERVED HYPOTHETICAL PROTEIN TM0937 A:4 -- 117
    1e-06  18%  1k78A1 [a.4.1.5] PAIRED BOX PROTEIN PAX5 A:19 -- 81
    1e-06  13%  2fnaA1 [a.4.5.11] CONSERVED HYPOTHETICAL PROTEIN A:284 -- 356
    2e-06  20%  2ethA1 [a.4.5.28] TRANSCRIPTIONAL REGULATOR, PUTATIVE, MAR FAMILY
    2e-06  33%  1mkmA1 [a.4.5.33] ICLR TRANSCRIPTIONAL REGULATOR A:1 -- 75
    2e-06  23%  1ub9A  [a.4.5.28] HYPOTHETICAL PROTEIN PH1061
    3e-06  21%  2a61A1 [a.4.5.28] TRANSCRIPTIONAL REGULATOR TM0710 A:5 -- 143
    3e-06  14%  1zybA1 [a.4.5.4] TRANSCRIPTION REGULATOR, CRP FAMILY A:148 -- 220
    4e-06  12%  2f2eA1 [a.4.5.69] PA1607 A:5 -- 146
    4e-06  20%  2fswA1 [a.4.5.69] PG_0823 PROTEIN A:3 -- 104
    5e-06  17%  1xcbA1 [a.4.5.38] REDOX-SENSING TRANSCRIPTIONAL REPRESSOR REX A:4
    5e-06  15%  1v4rA1 [a.4.5.6] TRANSCRIPTIONAL REPRESSOR A:1 -- 100
    6e-06  27%  1y0uA  [a.4.5.5] ARSENICAL RESISTANCE OPERON REPRESSOR, PUTATIVE
    9e-06  11%  2oa4A1 [a.4.12.3] SIR5 A:1 -- 93
    9e-06  15%  1fp2A1 [a.4.5.29] ISOFLAVONE O-METHYTRANSFERASE A:8 -- 108
    1e-05  15%  2g9wA1 [a.4.5.39] CONSERVED HYPOTHETICAL PROTEIN A:3 -- 124
    1e-05  14%  2fxaA1 [a.4.5.28] PROTEASE PRODUCTION REGULATORY PROTEIN HPR A:6 --
    1e-05  18%  3ctaA1 [a.4.5.28] RIBOFLAVIN KINASE A:5 -- 89
    2e-05  19%  2obpA1 [a.4.5.71] PUTATIVE DNA-BINDING PROTEIN A:12 -- 92
    2e-05  26%  1ku9A  [a.4.5.36] HYPOTHETICAL PROTEIN MJ223
    2e-05  28%  2d1hA1 [a.4.5.50] 109AA LONG HYPOTHETICAL TRANSCRIPTIONAL A:1 --
    5e-05  22%  2fbiA1 [a.4.5.28] PROBABLE TRANSCRIPTIONAL REGULATOR A:5 -- 140
    6e-05  17%  1p6rA  [a.4.5.39] PENICILLINASE REPRESSOR
    7e-05  19%  1dpuA  [a.4.5.16] REPLICATION PROTEIN A (RPA32) C-TERMINAL DOMAIN
    8e-05  15%  1xmkA1 [a.4.5.19] DOUBLE-STRANDED RNA-SPECIFIC ADENOSINE
    8e-05   8%  1tqiA1 [a.4.5.56] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 90
    1e-04  30%  1lvaA4 [a.4.5.35] SELENOCYSTEINE-SPECIFIC ELONGATION FACTOR A:575
    1e-04  18%  2p8tA1 [a.4.5.72] HYPOTHETICAL PROTEIN PH0730 A:14 -- 82
    1e-04  14%  1yg2A  [a.4.5.61] GENE ACTIVATOR APHA
    1e-04  17%  1p4xA2 [a.4.5.28] STAPHYLOCOCCAL ACCESSORY REGULATOR A HOMOLOGUE
    2e-04  28%  1i1gA1 [a.4.5.32] TRANSCRIPTIONAL REGULATOR LRPA A:2 -- 61
    2e-04  20%  1sfxA  [a.4.5.50] CONSERVED HYPOTHETICAL PROTEIN AF2008
    3e-04  15%  1jhfA1 [a.4.5.2] LEXA REPRESSOR A:2 -- 72
    3e-04   7%  1aoyA  [a.4.5.3] ARGININE REPRESSOR
    4e-04  12%  1xd7A  [a.4.5.55] YWNA
    4e-04  16%  1xn7A  [a.4.5.62] HYPOTHETICAL PROTEIN YHGG
    5e-04  21%  1on1A1 [a.4.5.24] TRANSCRIPTIONAL REGULATOR MNTR A:2 -- 62
    5e-04  15%  1p4xA1 [a.4.5.28] STAPHYLOCOCCAL ACCESSORY REGULATOR A HOMOLOGUE
    7e-04  10%  1xmaA  [a.4.5.61] PREDICTED TRANSCRIPTIONAL REGULATOR
    8e-04  13%  1e2xA1 [a.4.5.6] FATTY ACID METABOLISM REGULATOR PROTEIN A:6 --
:121

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MLNYSDPHVALDATFQALADTTRRTMLAQLARGPLSVTELARPLAMSLPAVMQHLSVLEQAGLVRTEKVG
1r1uA           ----------VTEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQG
1ulyA           ----------DPEVIKVXLEDTRRKILKLLRNKEXTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTE
1fnnA1          ----------LAIVRSLKISHTPYITFGDAEESYKIVCEEYGERPRVHSQLWSYLNDLREKGIVETRQNT
1r1tA           -------------FFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQG
1cgpA1          ----------IAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKT
2cohA1          ------------AALLELSETPLAHEEEGKVVLKATHDELAAAVGSVRETVTKVIGELAREGYIRSGYGK
1z05A1          ----------------HIKQINAGRVYKLIDQGPISRIDLSKESELAPASITKITRELIDAHLIHETTVQ
2h6bA1          ----------ILRLFYELCSSQGKRVGDTYEIMPLSQKSIGEITGVHHVTVSRVLACLKRENILDKKKNK
2gauA1          ----------LAETLLILKENFGFENDGATLSIYLSREELATLSNMTVSNAIRTLSTFVSERMLALDGKR
2jn6A1          ---------------KTYSEEFKRDAVALYENDGASLQQIANDLGINRVTLKNWIIKYGSNHNVQGTTPS
2p4wA1          ---------ELNRLLDVLGNETRRRILFLLTKRPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVEK
2b0lA1          ----AVVQMAISSLSYSELEAIEHIFEELDGNELLVASKIADRVGITRSVIVNALRKLESAGVIESRSLG
2hoeA1          -------------------------ILKRIXKSPVSRVELAEELGLTKTTVGEIAKIFLEKGIVVEEKDS
1ft9A1          --------------AGFFIDHANTTGRQTGVIVDFTVEEIANLIGSSRQTTSTALNSLIKEGYISRQGRG
2hs5A1          --------------TTRVAGILRDAIIDGTFRARLSEPDICAALDVSRNTVREAFQILIEDRLVAHELNR
2dk5A1          ---------QNAGKMKGSDNQEKLQIIEDAGNKGIWSRDVRYKSNLPLTEINKILKNLESKKLIKAVK--
1lvaA3          --------------FSETQKKLLKDLEDKYRVSPPSFKEVAGSFNLDPSELEELLHYLVREGVLVKINDE
1z6rA1          -----------------IKQTNAGAVYRLIDQGPVSRIDLSRLAQLAPASITKIVHEXLEAHLVQELGL-
1wi9A           ------------------SSGFLTEFINYIKKKVVLLEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDD
1u2wA1          ----------VSQILKAIADENRAKITYALCQEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRLAL
1q1hA           MVNAED-------LFINLAKSLLGDDVIDVLRTEMTDEEIANQLNIKVNDVRKKLNLLEEQGFVSYRKTR
1mzbA           ---------SELRKAGLKVTLPRVKILQMLDSAQVYKALMEAGEDVGLATVYRVLTQFEAAGLVRHNFDG
1oyiA           -------------------------AIKTIGIEGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDI
1sfuA           ---------------AEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSN
1biaA1          -----------------KDNTVPLKLIALLANGFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPG
1qbjA           -----------------IYQDQEQRILKFLEEKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGT
2co5A1          ---------------------NYYIILKVLVINGSRLEKKRLRIDISDGVLYPLIDSLIDDKILREEEAP
2htjA1          ----------------------KNEILEFLNRNGGKTAEIAEALAVTDYQARYYLLLLEKAGMVQRSPLR
2eshA1          --------------STILLLVAEKPSHGYELAERLAEFGIEIPGIGHMGNIYRVLADLEESGFLSTEWDT
1k78A1          ---------GVFVNGRPLPDVVRQRIVELAHQG-VRPCDISRQLRVSHGCVSKILGRYYETGSIK-----
2fnaA1          -------------------ARKRYLNIXRTLSKVKRALELEEGIEISDSEIYNYLTQLTKHSWIIKEGEK
2ethA1          -----------------------YAFLYVALFGPKKXKEIAEFLSTTKSNVTNVVDSLEKRGLVVREVDR
1mkmA1          -------------------------------PGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDK
1ub9A           ---------KEIMKSHILGNPVRLGIMIFLLPRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKVI
2a61A1          -------------------TPAQFDILQKIYFGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLPDPADR
1zybA1          --------------KSKIIRFFLSHCEKPQGEFKVKXDDLARCLDDTRLNISKTLNELQDNGLIELHRKE
2f2eA1          ---------PVARPLDVIGDGWSXLIVRDAFEGLTRFGEFQKSLGLAKNILAARLRNLVEHVXVAVPAES
2fswA1          ---------PVRKSXQIFAGKWTLLIIFQINRRIIRYGELKRAIGISEKXLIDELKFLCGKGLIKKKQYP
1xcbA1          --------------AAISRLITYLRILEELEAHRTSSEQLGELAQVTAFQVRKDLSYFGSYGTRGVGYTV
1v4rA1          --------------YADVATHFRTLIKSGELATLPSVADIRAQFGVAAKTVSRALAVLKSEGLVSSRG-A
1y0uA           ---------YHKRYNYAVTNPVRRKILRXLDKG-RSEEEIXQTLSLSKKQLDYHLKVLEAGFCIERVGER
2oa4A1          --------------TRRWVASRKIAVVRGVIYGLITLAEAKQTYGLSDEEFNSWVSALAEHGKDALKVTA
1fp2A1          -------HIYAFIDSMSLKWAVEMNIPNIIQNKPISLSNLVSILQVPIGNVRRLMRYLAHNGFFEIITKE
2g9wA1          -------------------GDLERAVXDHLWSRPQTVRQVHEALSLAYTTVXAVLQRLAKKNLVLQIRAH
2fxaA1          -------------------NINEHHILWIAYQNGASISEIAKFGVXHVSTAFNFSKKLEERGYLRFSKRT
3ctaA1          -------------------------------RAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTK
2obpA1          -----------------------REAGIENGATPWSLPKIAKRAQLPXSVLRRVLTQLQAAGLADVSVEA
1ku9A           -----------------------------LSDKPLTISDIXEELKISKGNVSXSLKKLEELGFVRKVWIK
2d1hA1          -----------------ITDTDVAVLLKXVIEKPITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTP
2fbiA1          -----------------------RVIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVKAPKDQ
1p6rA           -------------------SDAELEVMKVIWKTNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEG
1dpuA           ---------------------AQNQVLNLIKAEGLNFQDLKNQLKMSVSSIKQAVDFLSNEGHITVDDDH
1xmkA1          -------------------AEIKEKICDYLFNSDSSALNLAKNIGLTARDINAVLIDMERQGDVYRQGTT
1tqiA1          ---------NIAELYGKM-GKHSWRIMDAIFKEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNR-QK
1lvaA4          ----------------------AREVIKNLASGPFGLAEARDALGSSRKYVLPLLEYLDQVKFTRRVGDK
2p8tA1          -------------------------AVIFLLKEPLGRKQISERLELGEGSVRTLLRKLSHLDIIRSKGH-
1yg2A           --------------------SLPHVILTVLSTRDATGYDITKEFKASHQQVYRELNKMGEQGLVTCVLEV
1p4xA2          --------------------------ITSQNKNIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERDE
1i1gA1          -------------------DERDKIILEILEKARTPFTEIAKKLGISETAVRKRVKALEEKGIIE-----
1sfxA           -------------------KPSDVRIYSLLLEGGXRVSEIARELDLSARFVRDRLKVLLKRGFVREIVEK
1jhfA1          -------------------TARQQEVFDLIRDHPPTRAEIAQRLGFRSPNAEEHLKALARKGVIEIVSGA
1aoyA           -----------------KQEELVKAFKALLKEEKFAALQEQGFDNINQSKVSRMLTKFGAVRTRNAKMEM
1xd7A           --------------------------------EKTSSEIIADSVNTNPVVVRRMISLLKKADILTSRAGV
1xn7A           ---------------------SLIQVRDLLALGRMEAAQISQTLNTPQPMINAMLQQLESMGKAVRIQEE
1on1A1          -------------------------------KGYARVSDIAEALAVHPSSVTKMVQKLDKDEYL------
1p4xA1          --------------------------LFHQQENTLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSK
1xmaA           ---------------DVIRGYVDTIILSLLIEGDNIRIKTDELYVIKETTLYSAFARLEKNGYIKSYYGE
1e2xA1          ---------------QSPAGFAEEYIIESIWNNRFAERELSELIGVTRTTLREVLQRLARDGWLTIQ---


                         .         .         *         .         .         .         .:140
query           RVRTCTMAPKALSEAEQWINARRAEWEGHFDRLGEYLETMKKExxxxxxxx
1r1uA           QSMIYSLDDIHVATMLKQA--------------------------------
1ulyA           XKGNLVEKYYGRTALYLGDEELRYIARSRLKTKIDIFKRL-----------
1fnnA1          TLISIGTEPLDTLEAVITK--------------------------------
1r1tA           RHVYYQLQDHHIVALYQNA--------------------------------
1cgpA1          IV-------------------------------------------------
2cohA1          IQLLDLKGLKELAES------------------------------------
1z05A1          EAISRGRPAVGLQ--------------------------------------
2h6bA1          IIVYNLGELKHLSE-------------------------------------
2gauA1          IKIIDCDRLQKTARS------------------------------------
2jn6A1          AAVSEAEQIRQLKKENALQRARTR---------------------------
2p4wA1          IPRGRPRKYYMIKKGLRLEILLTPTLFGSEM--------------------
2b0lA1          MKGT-----------------------------------------------
2hoeA1          PRP------------------------------------------------
1ft9A1          HYTIPNLVR------------------------------------------
2hs5A1          GVF------------------------------------------------
2dk5A1          ---------------------------------------------------
1lvaA3          F--------------------------------------------------
1z6rA1          ---------------------------------------------------
1wi9A           RGKFIYITPSGPS--------------------------------------
1u2wA1          YSLG-----------------------------------------------
1q1hA           SGWFIYYWKPNIDQ-------------------------------------
1mzbA           GHAVFELAD------------------------------------------
1oyiA           PPR------------------------------------------------
1sfuA           PPK------------------------------------------------
1biaA1          K--------------------------------------------------
1qbjA           PPL------------------------------------------------
2co5A1          DGKVLFLTEKGMKEFEE----------------------------------
2htjA1          RGMATYWFLKGEKQA------------------------------------
2eshA1          TVSPPRKIYRITPQGKLYLREILRSLEDMKRRIETLEERIKRV--------
1k78A1          ---------------------------------------------------
2fnaA1          YC-------------------------------------------------
2ethA1          RTYRVVLTEKGKEIFGEILSNFESLLKSVLEKFSE----------------
1mkmA1          RYV------------------------------------------------
1ub9A           ADRP-----------------------------------------------
2a61A1          RAYFLVITRKGEEVIEKVIERRENFIEKITSDLGK----------------
1zybA1          ILI---PDAQKL---------------------------------------
2f2eA1          GSHQEYRLTDKGRALFPLLVAIRQWGEDYFFAPDESHVR------------
2fswA1          EVPP-----------------------------------------------
1xcbA1          PVL------------------------------------------------
1v4rA1          LGTVVEKNPIVITGADR----LKRMEKNGMRYA------------------
1y0uA           WVVT-----------------------------------------------
2oa4A1          L--------------------------------------------------
1fp2A1          EESALTVASELLVRGS-----------------------------------
2g9wA1          RYAPVHGRDELVAGLXVDALAQAEDSGSRQAALVHFVERV-----------
2fxaA1          YVQLTEEGTEVFWSLLEEFDPTRNAVFKGSQPLYH----------------
3ctaA1          RGQILNITEKGLDVLYTEFADLSRILA------------------------
2obpA1          D--------------------------------------------------
1ku9A           GERKNYYAVDGFSSIKD-IAKRKHD--------------------------
2d1hA1          K--------------------------------------------------
2fbiA1          RRVYVNLTEK----GQQCFVSMSGDMEKNYQRIQE----------------
1p6rA           RVFVYTPNIDESDY-------------------------------------
1dpuA           FKST-----------------------------------------------
1xmkA1          PPI------------------------------------------------
1tqiA1          DYEGSTFTFIGLSLYSLHRLVRSGK--------------------------
1lvaA4          RV-------------------------------------------------
2p8tA1          ---------------------------------------------------
1yg2A           YSIT----QAGRSALGEWFDQPTAHPTVRDEFSAKLMA-------------
1p4xA2          RKILIHMDDAQQDHAEQLLAQVN-QLLADKDHLHLVFE-------------
1i1gA1          ---------------------------------------------------
1sfxA           GWVGYIYSAEKPEKVKEFKSSILGEIERIEKXFTD----------------
1jhfA1          SRGIRLLQEE-----------------------------------------
1aoyA           VYC------------------------------------------------
1xd7A           PGASLKKDPADISLLEVYRAVQKNPKCPVGKKIQN----------------
1xn7A           PDGCLSGSCKSCPEGKACLRE------------------------------
1on1A1          ---------------------------------------------------
1p4xA1          IDER-----------------------------------------------
1xmaA           ETKR-----------------------------------------------
1e2xA1          ---------------------------------------------------