[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF08687.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1m1bA.bssp"
#ERROR : Can't open dsspfile "1jykA.bssp"
#ERROR : Can't open dsspfile "1dquA.bssp"
#ERROR : Can't open dsspfile "1f61A.bssp"
#ERROR : Can't open dsspfile "1mumA.bssp"
#ERROR : Can't open dsspfile "1tzfA.bssp"
#ERROR : Can't open dsspfile "1fwyA2.bssp"
#ERROR : Can't open dsspfile "1w55A1.bssp"
#ERROR : Can't open dsspfile "1qwjA.bssp"
#ERROR : Can't open dsspfile "1fxoA.bssp"
#ERROR : Can't open dsspfile "1yp2A2.bssp"
#ERROR : Can't open dsspfile "1w77A1.bssp"
#ERROR : Can't open dsspfile "2cu2A2.bssp"
#ERROR : Can't open dsspfile "1vpaA.bssp"
#ERROR : Can't open dsspfile "1e5kA.bssp"
#ERROR : Can't open dsspfile "1h3mA.bssp"
#ERROR : Can't open dsspfile "1m3uA.bssp"
#ERROR : Can't open dsspfile "2hxvA1.bssp"
#ERROR : Can't open dsspfile "2dpwA1.bssp"
#ERROR : Can't open dsspfile "1jv1A.bssp"
#ERROR : Can't open dsspfile "1dhpA.bssp"
#ERROR : Can't open dsspfile "1w37A.bssp"
#ERROR : Can't open dsspfile "1fdyA.bssp"
#ERROR : Can't open dsspfile "1q7mA1.bssp"
#ERROR : Can't open dsspfile "1xi3A.bssp"
#ERROR : Can't open dsspfile "1ojxA.bssp"
#ERROR : Can't open dsspfile "1gq9A.bssp"
#ERROR : Can't open dsspfile "1eyrA.bssp"
#ERROR : Can't open dsspfile "2aznA1.bssp"

## Summary of PDB Search
:564
    2e-33  69%  1m1bA  [c.1.12.7] PHOSPHOENOLPYRUVATE PHOSPHOMUTASE
    2e-27  34%  1jykA  [c.68.1.13] CTP:PHOSPHOCHOLINE CYTIDYLYTRANSFERASE
    1e-24  26%  1dquA  [c.1.12.7] ISOCITRATE LYASE
    4e-19  18%  1f61A  [c.1.12.7] ISOCITRATE LYASE
    2e-18  23%  1mumA  [c.1.12.7] 2-METHYLISOCITRATE LYASE
    5e-15  16%  1tzfA  [c.68.1.13] GLUCOSE-1-PHOSPHATE CYTIDYLYLTRANSFERASE
    5e-15  23%  1fwyA2 [c.68.1.5] UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE A:3 --
    6e-14  15%  1w55A1 [c.68.1.13] ISPD/ISPF BIFUNCTIONAL ENZYME A:3 -- 207
    7e-14  17%  1qwjA  [c.68.1.13] CYTIDINE MONOPHOSPHO-N-ACETYLNEURAMINIC ACID
    3e-13  22%  1fxoA  [c.68.1.6] GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE
    4e-13  18%  1yp2A2 [c.68.1.6] GLUCOSE-1-PHOSPHATE ADENYLYLTRANSFERASE SMALL
    9e-12  12%  1w77A1 [c.68.1.13] 2C-METHYL-D-ERYTHRITOL 4-PHOSPHATE A:75 -- 300
    1e-11  21%  2cu2A2 [c.68.1.20] PUTATIVE MANNOSE-1-PHOSPHATE GUANYLYL A:1 -- 268
    4e-11  19%  1vpaA  [c.68.1.13] 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE
    4e-11  19%  1e5kA  [c.68.1.8] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    1e-10  17%  1h3mA  [c.68.1.13] 2-C-METHYL-D-ERYTHRITOL 4-PHOSPHATE
    2e-10   8%  1m3uA  [c.1.12.8] 3-METHYL-2-OXOBUTANOATE HYDROXYMETHYLTRANSFERASE
    2e-10  11%  2hxvA1 [c.71.1.2] DIAMINOHYDROXYPHOSPHORIBOSYLAMINOPYRIMIDINE A:148
    2e-10  23%  2dpwA1 [c.68.1.19] HYPOTHETICAL PROTEIN TTHA0179 A:1 -- 231
    2e-10  14%  1jv1A  [c.68.1.5] GLCNAC1P URIDYLTRANSFERASE ISOFORM 1: AGX1
    2e-06  18%  1dhpA  [c.1.10.1] DIHYDRODIPICOLINATE SYNTHASE
    2e-05  13%  1w37A  [c.1.10.1] 2-KETO-3-DEOXY GLUCONATE ALDOLASE
    3e-05  21%  1fdyA  [c.1.10.1] N-ACETYLNEURAMINATE LYASE
    6e-05  10%  1q7mA1 [c.1.21.2] 5-METHYLTETRAHYDROFOLATE S-HOMOCYSTEINE A:301 --
    2e-04  14%  1xi3A  [c.1.3.1] THIAMINE PHOSPHATE PYROPHOSPHORYLASE
    2e-04  21%  1ojxA  [c.1.10.1] FRUCTOSE-BISPHOSPHATE ALDOLASE CLASS I
    3e-04  21%  1gq9A  [c.68.1.13] 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE
    6e-04  28%  1eyrA  [c.68.1.13] CMP-N-ACETYLNEURAMINIC ACID SYNTHETASE
    8e-04  23%  2aznA1 [c.71.1.2] PUTATIVE 5-AMINO-6-(5-PHOSPHORIBOSYLAMINO)URACIL
:564

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxNLLATSRSARLRQMLRSNELEFIMEAHNGLSARIVREAGFKGIWASGLAISAQFGVRDNNEASW
1m1bA           --------------TQLKQMLNSKDLEFIMEAHNGLSARIVQEAGFKGIWGSGLSVSAQLGVRDSNEASW
1jykA           ----------------------------------------------------------------------
1dquA           -----------------------------------------------------LWMAQLFHDRKQREERM
1f61A           ------HTLARRGAEVLWEQLHDLEWVNALGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDD
1mumA           ---------------AFRAALTKENPLQIVGTINANHALLAQRAGYQAIYLSGGGVAASLGLPDLGISTL
1tzfA           ----------------------------------------------------------------------
1fwyA2          ----------------------------------------------------------------------
1w55A1          ----------------------------------------------------------------------
1qwjA           ----------------------------------------------------------------------
1fxoA           ----------------------------------------------------------------------
1yp2A2          ----------------------------------------------------------------------
1w77A1          ----------------------------------------------------------------------
2cu2A2          ----------------------------------------------------------------------
1vpaA           ----------------------------------------------------------------------
1e5kA           ----------------------------------------------------------------------
1h3mA           ----------------------------------------------------------------------
1m3uA           --------------SLLQKYKQEKKRFATITAYDYSFAKLFADEGLNVMLVGDSLGMTVQGHDSTLPVTV
2hxvA1          ----------------------------------------------------------------------
2dpwA1          ----------------------------------------------------------------------
1jv1A           ----------------------------------------------------------------------
1dhpA           ----------------------------------------------------------------------
1w37A           ----------------------------------------------------------------------
1fdyA           ----------------------------------------------------------------------
1q7mA1          ----------------------------------------------------------------------
1xi3A           ----------------------------------------------------------------------
1ojxA           -------------------------------------LRLARDAGFRGIAEKYYDGSVPLILKEPVSVAN
1gq9A           ----------------------------------------------------------------------
1eyrA           ----------------------------------------------------------------------
2aznA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIEDKIFPKTNSFIGGEQQPLAD
1m1bA           TQVVEVLEFMSDASDVPILLDADTGYGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLAD
1jykA           ----------------------------------------------------------------------
1dquA           TTPKDQRHKVANVDYLPIIADADTGHGGLTAVMKLTKLFVERGAAGIHIEDQAPGTKG-------KVLVP
1f61A           QIAKIEGDTSVENWLAPIVADGEAGFGGALNVYELQKALIAAGVAGSHWEDQLASEKKCGHLGGKVL-IP
1mumA           DDVLTDIRRITDVCSLPLLVDADIGFGSAFNVARTVKSMIKAGAAGLHIEDQVGAKRCGHRPNKAIKEEM
1tzfA           ----------------------------------------------------------------------
1fwyA2          ----------------------------------------------------------------------
1w55A1          ----------------------------------------------------------------------
1qwjA           ----------------------------------------------------------------------
1fxoA           ----------------------------------------------------------------------
1yp2A2          ----------------------------------------------------------------------
1w77A1          ----------------------------------------------------------------------
2cu2A2          ----------------------------------------------------------------------
1vpaA           ----------------------------------------------------------------------
1e5kA           ----------------------------------------------------------------------
1h3mA           ----------------------------------------------------------------------
1m3uA           ADIAYHTAAVRRGNCLLLADLPFMAYATPEQAFENAATVMRAGANMVKIEGGEWLVETVQMLTE----RA
2hxvA1          ----------------------------------------------------------------------
2dpwA1          ----------------------------------------------------------------------
1jv1A           ----------------------------------------------------------------------
1dhpA           ----------------------EKGNVCRASLKKLIDYHVASGTSAIVSVGTT---------GESATL-N
1w37A           ----------------------KDNRIDKEKLKIHAENLIRKGIDKLFVNG---------TTGLGPSL-S
1fdyA           ---------------------------DKASLRRLVQFNIQQGIDGLYVG---------GSTGEAFVQ-S
1q7mA1          ----------------------------------------------------------------------
1xi3A           ----------------------------------------------------------------------
1ojxA           CSVEEAVSLGASAVGYTIYPGSGFEWKMFEELARIKRDAVKFDLP-LVVW--SYPR-----GGKVVNETA
1gq9A           ----------------------------------------------------------------------
1eyrA           ----------------------------------------------------------------------
2aznA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IDEFCGKIKAGKDSQADDDFSIVARVEALIAGWGMEEALRRAEAYRQAGADAILIHSKLSKADEIVTFAR
1m1bA           IEEFALKIKACKDSQTDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKADPSDIEAFMK
1jykA           ----------------------------------------------------------------------
1dquA           ISEHINRLVA-IRAQADTDLLAIARTDSEAAT-LITSTIHRDHPFIIGSTNPLMVMAEQAGKNELQAIED
1f61A           TQQHIRTLTSARLDVADVPTVVIARTDAEAATLGIEPCIARAKAYAPFADLIWMETGTPDL-----EAAR
1mumA           VDRIRAAVDAKTDPDFVIMARTDALAV-----EGLDAAIERAQAYVEAGAEMLFP---EAITELAMYRQF
1tzfA           ----------------------------------------------------------------------
1fwyA2          ----------------------------------------------------------------------
1w55A1          ----------------------------------------------------------------------
1qwjA           ----------------------------------------------------------------------
1fxoA           ----------------------------------------------------------------------
1yp2A2          ----------------------------------------------------------------------
1w77A1          ----------------------------------------------------------------------
2cu2A2          ----------------------------------------------------------------------
1vpaA           ----------------------------------------------------------------------
1e5kA           ----------------------------------------------------------------------
1h3mA           ----------------------------------------------------------------------
1m3uA           VPVCGHLGLTPQSVNIFGGYKVQGRGDEAGDQ--------------------------------------
2hxvA1          --------------------------------WITDKLRFKVHEXR-NIYSAVLVGAGTVLKDNPQLTCR
2dpwA1          ----------------------------------------------------------------------
1jv1A           ----------------------------------------------------------------------
1dhpA           HDEHADVVMMTLD-LADGRIPVIAGT----GANATAEAISLTQRFNDSGIVGCLTVT-------------
1w37A           PEEKLENLKAVYDVTNKII--------FQVGGLNLDDAIRLAKLSKDFDIVGIASYYPRMSEKHLVKYFK
1fdyA           LSEREQVLEIVAE-EGKGKIKLIAHV----GCVTTAESQQLAASAKRYGFDAVSAVTPFFSFEEHCDHYR
1q7mA1          ---------------------------AEMQKGNEEIVIKEAKTQVEKGAEVLDVNFGIESQIDVRYVEK
1xi3A           ----------------------------VITDRRLKPEVESVREALEGGATAIQMRIKNAPTREMYEIGK
1ojxA           PEIVAYAARIALELGADKTFSWAGKVPVLMSGGTEEDFLKQVEGVLEAGALGIAVGRNVWQRRDALKFAR
1gq9A           ----------------------------------------------------------------------
1eyrA           ----------------------------------------------------------------------
2aznA1          -------------------------------RISCEEDLIRVHKIR-ANVDGIXVGIGTVLKDDPRLTVH


                         .         .         .         +         .         .         .:280
query           EWAGRAPLVIVPTKYYSTPTDVFRKAGISLVIWANHLIRVAASSMQAVAREIHDSQTLVNVEDRIATVNE
1m1bA           AWNNQGPVVIVPTKYYKTPTDHFRDMGVSMVIWANHNLRASVSAIQQTTKQIYDDQSLVNVEDKIVSVKE
1jykA           ----------------------------------------------------------------------
1dquA           EWLAKAGL--------------------------------------------------------------
1f61A           QFSEAVKAEYPDQMLAYNCSPSFAAMGFKFQFITLAGFHALNYSMFDLAYGYAQNQM--SAYVELQEREF
1mumA           ADAVQVPILANITEFGATPTDELRSAHVAMALYPLSAFRAMNRAAEHVYNVLRQEGTQKSVIDTMQTRNE
1tzfA           ----------------------------------------------------------------------
1fwyA2          ----------------------------------------------------------------------
1w55A1          ----------------------------------------------------------------------
1qwjA           ----------------------------------------------------------------------
1fxoA           ----------------------------------------------------------------------
1yp2A2          ----------------------------------------------------------------------
1w77A1          ----------------------------------------------------------------------
2cu2A2          ----------------------------------------------------------------------
1vpaA           ----------------------------------------------------------------------
1e5kA           ----------------------------------------------------------------------
1h3mA           ----------------------------------------------------------------------
1m3uA           ----------------------------------------------------------------------
2hxvA1          LKEGRNPVRVILDRKGVLSGKRVFEENARVIVFTESEEAEYPPHVEKALSDCSVESILRNLYER--DIDS
2dpwA1          ----------------------------------------------------------------------
1jv1A           ----------------------------------------------------------------------
1dhpA           ----------------------------------------------------------------------
1w37A           TLCEVSPHPVYLYNYPTATGKDIDAK--------------------------------------------
1fdyA           AIIDSAD--GLPMVVYNIP---------------------------------------------------
1q7mA1          IVQTLPYVSNVPLSLDIQNVDLTERAYPGRSLFNSELEMKINLLKKYGGTLIVLLMGKDVPKSFEERKEY
1xi3A           TLRQLTREY-------------------------------------------------------------
1ojxA           ----------------------------------------------------------------------
1gq9A           ----------------------------------------------------------------------
1eyrA           ----------------------------------------------------------------------
2aznA1          KIKDRNPVRIVVDSKLRVPLNVLNKDAKTIIA--------------------------------------


                         .         *         .         .         .         .         +:350
query           IFRLQDADEYSAAEKIYLTGGQAPSSAVVLAAGRGKGLEALTEDKPKIMLPVAGKPLLRWLVDGFKNQGI
1m1bA           IFRLQRDDELVQAEDKYL----------------------------------------------------
1jykA           --------------------------AIILAAGLGTRLRPLTENTPKALVQVNQKPLIEYQIEFLKEKGI
1dquA           ----------------------------------------------------------------------
1f61A           AAEERGYTAT------------------------------------------------------------
1mumA           LYESINYYQYEEKLDNLF----------------------------------------------------
1tzfA           --------------------------AVILAGGLGV--------KPKPMVEIGGKPILWHIMKMYSVHGI
1fwyA2          -------------------------SVVILAAGKGTRM---YSDLPKVLHTLAGKAMVQHVIDAANELGA
1w55A1          --------------------------LIMLAAGNSTRF---NTKVKKQFLRLGNDPLWLYATKNLSSFYP
1qwjA           ----------------------PHLAALVLARGGSKGI------PLKNIKRLAGVPLIGWVLRAALDAGV
1fxoA           --------------------------GIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGI
1yp2A2          --------------------------ASRSVLGIILRLYPLTKKRAKPAVPLGANRLIDIPVSNCLNSNI
1w77A1          --------------------------VILLAGGSM----------PKQYIPLLGQPIALYSFFTFSRMPE
2cu2A2          --------------------------ALVMAGGRGERLWPLSEDRPKPFLPLEGKTLLEATLERLAPLVP
1vpaA           --------------------------AILLAAGKGERM---SENVPKQFLEIEGRMLFEYPLSTFKSEAI
1e5kA           --------------------------GVVLAGGKARRMGGV----DKGLLELNGKPLWQHVADALMTQLS
1h3mA           -------------------------CAVVPAAC------------PKQYLSIGNQTILEHSVHALLAHPR
1m3uA           ----------------------------------------------------------------------
2hxvA1          VLVEGGSKVFSEADVVFGF---------------------------------------------------
2dpwA1          -------------------------SAIVLAGGKEAWAERFGVG-SKALVPYRGRPXVEWVLEALYAAGL
1jv1A           --------------------------VLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQAERILKLQQ
1dhpA           ----------------------------------------------------------------------
1w37A           ----------------------------------------------------------------------
1fdyA           ----------------------------------------------------------------------
1q7mA1          FEKLKILERHDFSDRVIFDPGVLPLGAEGKPVEVLKTIEFISSKGFNTTVGLSNLSFGLPDRSYYNSKGL
1xi3A           ----------------------------------------------------------------------
1ojxA           ----------------------------------------------------------------------
1gq9A           --------------------------IVIPARYGSSRLPG------KPLLDIVGKPMIQHVYERALQAGV
1eyrA           --------------------------AVILARQNSKGL------PLKNLRKXNGISLLGHTINAAISSKC
2aznA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           NDITVVGGYKAEAIDAAGIKLVRNERHAATGELASLACAADSLETDTVVSYGDLMFRSYILRDLLETDAP
1m1bA           ----------------------------------------------------------------------
1jykA           NDIIIIVGYLKEQFDYLGVRLVFNDKYADYNNFYSLYLVKEELANSYVIDADNYLFKNXFRNDLTRST--
1dquA           ----------------------------------------------------------------------
1f61A           ----------------------------------------------------------------------
1mumA           ----------------------------------------------------------------------
1tzfA           KDFIICCGYKGYVIKEYFANYFLHMSDVTFHMAENRMEVHHKRVEPWNVTLGDSSMTGGRLKRVAEYVKD
1fwyA2          AHVHLVYGHGGDLLKQANLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPLSVETLQRLRDAKPQ
1w55A1          FKKIVVTSSNITYMKKFTKNYEF--IEGGDTRAESLKKALELIDSEFVM--------------VSDVARV
1qwjA           FQSVWVSTDHDEIENVAKQFGAQVHRRSSSTSLDAIVEFLNYHNEVDGNIQATSPCLHTDLQKVAEMIRE
1fxoA           REILIISTPQDQQLLGDGSNWGLDLQYAVQPSPDGLAIGESFIGNDLSA---------LVLGDNLYYGHD
1yp2A2          SKIYVLTQFNSASLNRHGFVEVLAAQQSPENPDWFQGTADEHTVLEYLILAGDHLYREKFIQAHRETDAD
1w77A1          VKEIVVVCDPFFRDIFESIDVDLRFAIPGKERQDSVYSGLQEIDVNSELVCIHDSARPLVNTEDVE----
2cu2A2          PERTLLARRDQEAVARPGIRLLLEPLGRDTAGAVLLGVAKEGAERLLVLPADHYVGDDEAYREALATAAE
1vpaA           DGVVIVTRREWFEVVEKRVFHEKVLGIVEGGDTQSVRSALEFLEKF----SPSYVLVHDSARPFLRKKHV
1e5kA           HVVVNANRHQEIYQ-ASGLKVIEDSLADYPGPLAGMLSVMQQEAGEWFCPCDTPYIPPDLAARLNHQRKD
1h3mA           VKRVVIAISPGDSRFAQLPLANHPQITVVDGGDERADSVLTGLKAAG--------------------DAQ
1m3uA           ----------------------------------------------------------------------
2hxvA1          ----------------------------------------------------------------------
2dpwA1          SPVYVG---ENPGLVPAPALTLP----DRGGLLENLEQALEHVEGRVLVATGDIPHTEEAVRFVLDPEAA
1jv1A           VAEKYYGNKCIIPW--------------------------------------------------------
1dhpA           ----------------------------------------------------------------------
1w37A           ----------------------------------------------------------------------
1fdyA           ----------------------------------------------------------------------
1q7mA1          SSAIMLDETLMKTLNATLVILEKKE---------------------------------------------
1xi3A           ----------------------------------------------------------------------
1ojxA           ----------------------------------------------------------------------
1gq9A           AEVWVATDDPEQAVQAFGGKAIMTRNDHESG-TDRLVEVMHKVEADIYINLGDEPMIRP---RDVET---
1eyrA           FDRIIVGGLIAEEAKNFGVEVVLRPAELASDTASSISGVIHALET-IGSNSGTVT--------LLQPTSP
2aznA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           FSVVVDSSESAPSNQSVRDFAWCSAADDRDLFGQKVLLRKISDTPAATDGEPHGRWIGLLNVRGEGRARL
1m1bA           ----------------------------------------------------------------------
1jykA           ----------------------------------------------------------------------
1dquA           ----------------------------------------------------------------------
1f61A           ----------------------------------------------------------------------
1mumA           ----------------------------------------------------------------------
1tzfA           DEAFLFTYGDGVADLDIKATIDFHKAHGKKATLTATGRFGALDIQAGQVRQEKPKGDGAMINGGFFVLNP
1fwyA2          GGIGL----------------LTVKLDDPTGYGRITRVTGIVEHKDATDEQRQIQEIGILIAN---GADM
1w55A1          L---------------VSKNLFDRLIENLDKADCITPALKVADTTLFDNEALQREK--IKLIQTPQISKT
1qwjA           -----------------EGYDSVFSVVRRHQFRWSEIQKGVREVTEPLNLNP------------AKRPRR
1fxoA           FHELLGSASQRQTGASV--FAYH--VLDPERYG-------------VVEFDQGGKAISLEEKPLEPKSNY
1yp2A2          ITVALPMDEKRATAFGLMKI-------DEE--GRIIEFAEKPQGEQLQAMKVDTTILGLDDKRAKEMPFI
1w77A1          --------------------KVLKDGSAVGAAVLGV-----------PAKATIKEVNSDSLVVTLWEMKP
2cu2A2          EGFVVALGLRPTRPETEYGYIRLGPREGAWYRGEGFVEKPSYAEALEYIRKGYVWNGGFRRHLPSHHEAL
1vpaA           SEVL-------------------RRARE---TGAATLALKNSDALVRVENDRIEYIPGVYRILTPQAFSY
1e5kA           APVVW-----------------------------------------------------------------
1h3mA           WVLVHDAARPCLHQDDLARLLALSETSRTGG----ILAAPVRDTMKRAEPG-KNAIAHTVDRNGTPQFFP
1m3uA           ----------------------------------------------------------------------
2hxvA1          ----------------------------------------------------------------------
2dpwA1          LVYPIVPKEA------------------------------------------------------------
1jv1A           ----------------------------------------------------------------------
1dhpA           ----------------------------------------------------------------------
1w37A           ----------------------------------------------------------------------
1fdyA           ----------------------------------------------------------------------
1q7mA1          ----------------------------------------------------------------------
1xi3A           ----------------------------------------------------------------------
1ojxA           ----------------------------------------------------------------------
1gq9A           ---LLQGMRDDPALPVATLCHAISAAEAAEPSTVKVVVNTRQDYPRNAEKARYLKHVGIYAYR---RDVL
1eyrA           L---------------------------------------------------------------------
2aznA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           QKLLAELRQRPDFDSLDMPDLINALVEAGEKVEVRYVHGHWRGVNDLEDFRRAGDFAHTQxxxxxxxxxx
1m1bA           ----------------------------------------------------------------------
1jykA           ----------------------------------------------------------------------
1dquA           ----------------------------------------------------------------------
1f61A           ----------------------------------------------------------------------
1mumA           ----------------------------------------------------------------------
1tzfA           SVIDLIDNDATTWEQEPLMTLA-----QQGELMAFEHPGFWQPMDTLRDKVYL-----------------
1fwyA2          KRWLAKLTNNNAQGEYYITDIIALAYQEGREIVAVHPQRLSEGVNNRLQLSRL-----------------
1w55A1          KLLKKALDQNLEF-----TDDSTAIAAMGGKIWFVEGEENARKLTFKEDLKKL-----------------
1qwjA           QDWDGELYENGSFYFAKRHLIEMGYLQGGKMAYYEMRAEHSVDIDVDIDWPIA-----------------
1fxoA           QQVVDIARDLKPSPRLEITDVNRAYLERGQLSVEIMGRGYWLDTGTHDSLLEAGQFIATL----------
1yp2A2          KDVMLNLLRDKFPGANDGSEVIPGATSLGMRVQAYLYDGYWEDIGTIEAFYNA-----------------
1w77A1          ELLKKGFELVKSEG--LEVTDVSIVEYLKHPVYVSQGSYTNIKVTTPDDLLLA-----------------
2cu2A2          ERLLAGASLEEVYAGLPKISIDYGVMEKAERVRVVLGRFPWDDVGNWRALERVFS---------------
1vpaA           EILKKAHENGGEW-----ADDTEPVQKLGVKIALVEGDPLCFKVTFKEDLELA-----------------
1e5kA           ----------------------------------------------------------------------
1h3mA           RELLHDCLTRALNEGATITDEASALEYCGFHPQLVEGRADNIKVTRPEDLALA-----------------
1m3uA           ----------------------------------------------------------------------
2hxvA1          ----------------------------------------------------------------------
2dpwA1          ----------------------------------------------------------------------
1jv1A           ----------------------------------------------------------------------
1dhpA           ----------------------------------------------------------------------
1w37A           ----------------------------------------------------------------------
1fdyA           ----------------------------------------------------------------------
1q7mA1          ----------------------------------------------------------------------
1xi3A           ----------------------------------------------------------------------
1ojxA           ----------------------------------------------------------------------
1gq9A           QNY-SQLPESMQAESLEQ----LRLMNAGINIRTFEVAATGPGVDTPACLEKV-----------------
1eyrA           ----------------------------------------------------------------------
2aznA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxx
1m1bA           ----
1jykA           ----
1dquA           ----
1f61A           ----
1mumA           ----
1tzfA           ----
1fwyA2          ----
1w55A1          ----
1qwjA           ----
1fxoA           ----
1yp2A2          ----
1w77A1          ----
2cu2A2          ----
1vpaA           ----
1e5kA           ----
1h3mA           ----
1m3uA           ----
2hxvA1          ----
2dpwA1          ----
1jv1A           ----
1dhpA           ----
1w37A           ----
1fdyA           ----
1q7mA1          ----
1xi3A           ----
1ojxA           ----
1gq9A           ----
1eyrA           ----
2aznA1          ----