[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF08803.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1pwxA.bssp"
#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "1xg5A.bssp"
#ERROR : Can't open dsspfile "1bdbA.bssp"
#ERROR : Can't open dsspfile "1zemA1.bssp"
#ERROR : Can't open dsspfile "1fjhA.bssp"
#ERROR : Can't open dsspfile "1yb1A.bssp"
#ERROR : Can't open dsspfile "1n5dA.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "1nasA.bssp"
#ERROR : Can't open dsspfile "2gdzA1.bssp"
#ERROR : Can't open dsspfile "1c14A.bssp"
#ERROR : Can't open dsspfile "1snyA.bssp"
#ERROR : Can't open dsspfile "1h5qA.bssp"
#ERROR : Can't open dsspfile "2c54A1.bssp"
#ERROR : Can't open dsspfile "1dhrA.bssp"
#ERROR : Can't open dsspfile "1spxA.bssp"
#ERROR : Can't open dsspfile "1w6uA.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "2ag5A1.bssp"
#ERROR : Can't open dsspfile "2zqnA1.bssp"
#ERROR : Can't open dsspfile "1o5iA.bssp"
#ERROR : Can't open dsspfile "1x74A1.bssp"
#ERROR : Can't open dsspfile "1xseA.bssp"
#ERROR : Can't open dsspfile "1u7uA.bssp"
#ERROR : Can't open dsspfile "1u9jA.bssp"
#ERROR : Can't open dsspfile "1jr2A.bssp"
#ERROR : Can't open dsspfile "1nytA1.bssp"
#ERROR : Can't open dsspfile "1lu9A1.bssp"
#ERROR : Can't open dsspfile "2bgkA1.bssp"
#ERROR : Can't open dsspfile "1vlwA.bssp"
#ERROR : Can't open dsspfile "1vhcA.bssp"
#ERROR : Can't open dsspfile "1di6A.bssp"
#ERROR : Can't open dsspfile "1h2iA.bssp"
#ERROR : Can't open dsspfile "1yxmA1.bssp"
#ERROR : Can't open dsspfile "1bvrA.bssp"
#ERROR : Can't open dsspfile "1yo6A1.bssp"
#ERROR : Can't open dsspfile "1b8pA1.bssp"
#ERROR : Can't open dsspfile "1vm6A3.bssp"
#ERROR : Can't open dsspfile "1zbqA1.bssp"
#ERROR : Can't open dsspfile "2ib0A1.bssp"
#ERROR : Can't open dsspfile "1e5lA2.bssp"
#ERROR : Can't open dsspfile "1c3vA1.bssp"
#ERROR : Can't open dsspfile "1a9yA.bssp"
#ERROR : Can't open dsspfile "2fr0A1.bssp"
#ERROR : Can't open dsspfile "1a4iA1.bssp"
#ERROR : Can't open dsspfile "2bd0A1.bssp"
#ERROR : Can't open dsspfile "1qp8A1.bssp"
#ERROR : Can't open dsspfile "1ujmA.bssp"
#ERROR : Can't open dsspfile "1rkxA.bssp"
#ERROR : Can't open dsspfile "1bw3A.bssp"
#ERROR : Can't open dsspfile "2a35A1.bssp"
#ERROR : Can't open dsspfile "1adeA.bssp"
#ERROR : Can't open dsspfile "1hdoA.bssp"
#ERROR : Can't open dsspfile "1a4uA.bssp"
#ERROR : Can't open dsspfile "1i24A.bssp"
#ERROR : Can't open dsspfile "2joeA1.bssp"
#ERROR : Can't open dsspfile "1qycA.bssp"
#ERROR : Can't open dsspfile "2bkaA1.bssp"
#ERROR : Can't open dsspfile "1gu7A2.bssp"
#ERROR : Can't open dsspfile "1e1cA2.bssp"
#ERROR : Can't open dsspfile "2gdtA1.bssp"
#ERROR : Can't open dsspfile "1pjqA1.bssp"
#ERROR : Can't open dsspfile "1ftrA1.bssp"
#ERROR : Can't open dsspfile "1qorA2.bssp"
#ERROR : Can't open dsspfile "1sb8A.bssp"
#ERROR : Can't open dsspfile "1edzA1.bssp"
#ERROR : Can't open dsspfile "1bxkA.bssp"
#ERROR : Can't open dsspfile "2hjsA1.bssp"
#ERROR : Can't open dsspfile "1vl0A.bssp"
#ERROR : Can't open dsspfile "1bsvA.bssp"
#ERROR : Can't open dsspfile "2b69A1.bssp"
#ERROR : Can't open dsspfile "1npdA1.bssp"
#ERROR : Can't open dsspfile "1aorA1.bssp"
#ERROR : Can't open dsspfile "1db3A.bssp"
#ERROR : Can't open dsspfile "1eq2A.bssp"
#ERROR : Can't open dsspfile "1gefA.bssp"
#ERROR : Can't open dsspfile "1cjcA1.bssp"
#ERROR : Can't open dsspfile "1orrA.bssp"
#ERROR : Can't open dsspfile "1d0iA.bssp"
#ERROR : Can't open dsspfile "1a2zA.bssp"
#ERROR : Can't open dsspfile "1k6iA.bssp"
#ERROR : Can't open dsspfile "1lssA.bssp"
#ERROR : Can't open dsspfile "1p9oA.bssp"
#ERROR : Can't open dsspfile "1kbzA.bssp"

## Summary of PDB Search
:238
    4e-39  18%  1pwxA  [c.2.1.2] HALOHYDRIN DEHALOGENASE
    2e-35  27%  1a27A  [c.2.1.2] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    2e-34  32%  1xg5A  [c.2.1.2] ARPG836
    3e-32  24%  1bdbA  [c.2.1.2] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
    2e-30  30%  1zemA1 [c.2.1.2] XYLITOL DEHYDROGENASE A:3 -- 262
    3e-30  33%  1fjhA  [c.2.1.2] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL
    7e-30  25%  1yb1A  [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
    1e-29  24%  1n5dA  [c.2.1.2] CARBONYL REDUCTASE/20BETA-HYDROXYSTEROID
    8e-29  27%  1ahhA  [c.2.1.2] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    9e-29  31%  1ae1A  [c.2.1.2] TROPINONE REDUCTASE-I
    1e-28  20%  1nasA  [c.2.1.2] SEPIAPTERIN REDUCTASE
    7e-28  30%  2gdzA1 [c.2.1.2] NAD+-DEPENDENT 15-HYDROXYPROSTAGLANDIN A:3 -- 256
    1e-26  19%  1c14A  [c.2.1.2] ENOYL REDUCTASE
    3e-26  22%  1snyA  [c.2.1.2] SNIFFER CG10964-PA
    7e-26  26%  1h5qA  [c.2.1.2] NADP-DEPENDENT MANNITOL DEHYDROGENASE
    3e-25  10%  2c54A1 [c.2.1.2] GDP-MANNOSE-3', 5'-EPIMERASE A:13 -- 374
    2e-24  16%  1dhrA  [c.2.1.2] DIHYDROPTERIDINE REDUCTASE
    5e-24  24%  1spxA  [c.2.1.2] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5L265)
    2e-23  25%  1w6uA  [c.2.1.2] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    2e-23  23%  1dohA  [c.2.1.2] TRIHYDROXYNAPHTHALENE REDUCTASE
    3e-23  28%  2ag5A1 [c.2.1.2] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6 A:1
    7e-23   8%  2zqnA1 [b.42.2.1] 29-KDA GALACTOSE-BINDING LECTIN A:131 -- 260
    8e-21  29%  1o5iA  [c.2.1.2] 3-OXOACYL-(ACYL CARRIER PROTEIN) REDUCTASE
    6e-20  14%  1x74A1 [c.123.1.1] 2-METHYLACYL-COA RACEMASE A:2 -- 360
    7e-20  22%  1xseA  [c.2.1.2] 11BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 1
    1e-18   7%  1u7uA  [c.72.3.1] COENZYME A BIOSYNTHESIS BIFUNCTIONAL PROTEIN
    1e-18  10%  1u9jA  [c.2.1.2] HYPOTHETICAL PROTEIN YFBG
    3e-18  12%  1jr2A  [c.113.1.1] UROPORPHYRINOGEN-III SYNTHASE
    3e-18  13%  1nytA1 [c.2.1.7] SHIKIMATE 5-DEHYDROGENASE A:102 -- 271
    3e-17  13%  1lu9A1 [c.2.1.7] METHYLENE TETRAHYDROMETHANOPTERIN DEHYDROGENASE
    3e-17  21%  2bgkA1 [c.2.1.2] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE A:11 --
    4e-17  10%  1vlwA  [c.1.10.1] 2-DEHYDRO-3-DEOXYPHOSPHOGLUCONATE ALDOLASE/4-
    2e-16   8%  1vhcA  [c.1.10.1] PUTATIVE KHG/KDPG ALDOLASE
    2e-16  12%  1di6A  [c.57.1.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    5e-16   9%  1h2iA  [d.50.1.3] DNA REPAIR PROTEIN RAD52 HOMOLOG
    6e-16  26%  1yxmA1 [c.2.1.2] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE A:7 -- 303
    6e-16  18%  1bvrA  [c.2.1.2] PROTEIN (ENOYL-ACYL CARRIER PROTEIN (ACP)
    2e-15  22%  1yo6A1 [c.2.1.2] PUTATIVE CARBONYL REDUCTASE SNIFFER A:1 -- 250
    1e-14  10%  1b8pA1 [c.2.1.5] PROTEIN (MALATE DEHYDROGENASE) A:3 -- 158
    1e-14   8%  1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 --
    2e-14  26%  1zbqA1 [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE 4 A:3 -- 304
    3e-14  12%  2ib0A1 [a.25.1.9] CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN A:17
    6e-14  13%  1e5lA2 [d.81.1.2] SACCHAROPINE REDUCTASE A:125 -- 391
    7e-14  11%  1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:715
    1e-13  13%  1a9yA  [c.2.1.2] UDP-GALACTOSE 4-EPIMERASE
    3e-13  16%  2fr0A1 [c.2.1.2] ERYTHROMYCIN SYNTHASE, ERYAI A:1657 -- 1915
    1e-12   8%  1a4iA1 [c.2.1.7] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:127 --
    2e-12  23%  2bd0A1 [c.2.1.2] SEPIAPTERIN REDUCTASE A:2 -- 241
    2e-12  19%  1qp8A1 [c.2.1.4] FORMATE DEHYDROGENASE A:83 -- 263
    3e-12  21%  1ujmA  [c.2.1.2] ALDEHYDE REDUCTASE II
    3e-12  14%  1rkxA  [c.2.1.2] CDP-GLUCOSE-4,6-DEHYDRATASE
    9e-12   9%  1bw3A  [b.52.1.2] BARWIN, BASIC BARLEY SEED PROTEIN
    2e-11  12%  2a35A1 [c.2.1.2] HYPOTHETICAL PROTEIN PA4017 A:4 -- 215
    2e-11  16%  1adeA  [c.37.1.10] ADENYLOSUCCINATE SYNTHETASE
    3e-11  15%  1hdoA  [c.2.1.2] BILIVERDIN IX BETA REDUCTASE
    4e-11  21%  1a4uA  [c.2.1.2] ALCOHOL DEHYDROGENASE
    9e-11  10%  1i24A  [c.2.1.2] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1
    1e-10  10%  2joeA1 [d.371.1.1] HYPOTHETICAL LIPOPROTEIN YEHR A:2 -- 131
    5e-10  13%  1qycA  [c.2.1.2] PHENYLCOUMARAN BENZYLIC ETHER REDUCTASE PT1
    5e-10   9%  2bkaA1 [c.2.1.2] TAT-INTERACTING PROTEIN TIP30 A:5 -- 236
    5e-10   9%  1gu7A2 [c.2.1.1] 2,4-DIENOYL-COA REDUCTASE A:161 -- 349
    3e-08  12%  1e1cA2 [c.23.6.1] METHYLMALONYL-COA MUTASE ALPHA CHAIN A:561 -- 728
    3e-08  17%  2gdtA1 [d.346.1.1] LEADER PROTEIN P65 HOMOLOG NSP1 (EC 3.4.22.-)
    6e-08  15%  1pjqA1 [c.2.1.11] SIROHEME SYNTHASE A:1 -- 113
    1e-07  11%  1ftrA1 [d.58.33.1] FORMYLMETHANOFURAN\:TETRAHYDROMETHANOPTERIN A:1
    2e-07  14%  1qorA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:113 -- 291
    2e-07  19%  1sb8A  [c.2.1.2] WBPP
    8e-07  12%  1edzA1 [c.2.1.7] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE A:149
    2e-06  20%  1bxkA  [c.2.1.2] PROTEIN (DTDP-GLUCOSE 4,6-DEHYDRATASE)
    2e-06  23%  2hjsA1 [c.2.1.3] USG-1 PROTEIN HOMOLOG A:3 -- 129 A:320 -- 336
    3e-06  22%  1vl0A  [c.2.1.2] DTDP-4-DEHYDRORHAMNOSE REDUCTASE, RFBD ORTHOLOG
    4e-06  18%  1bsvA  [c.2.1.2] PROTEIN (GDP-FUCOSE SYNTHETASE)
    6e-06  17%  2b69A1 [c.2.1.2] UDP-GLUCURONATE DECARBOXYLASE 1 A:4 -- 315
    8e-06  11%  1npdA1 [c.2.1.7] HYPOTHETICAL SHIKIMATE 5-DEHYDROGENASE-LIKE A:107
    9e-06  12%  1aorA1 [a.110.1.1] ALDEHYDE FERREDOXIN OXIDOREDUCTASE A:211 --
    3e-05  17%  1db3A  [c.2.1.2] GDP-MANNOSE 4,6-DEHYDRATASE
    4e-05  32%  1eq2A  [c.2.1.2] ADP-L-GLYCERO-D-MANNOHEPTOSE 6-EPIMERASE
    5e-05  11%  1gefA  [c.52.1.18] HOLLIDAY JUNCTION RESOLVASE
    6e-05  10%  1cjcA1 [c.3.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:107 -- 331
    1e-04  23%  1orrA  [c.2.1.2] CDP-TYVELOSE-2-EPIMERASE
    2e-04  14%  1d0iA  [c.23.13.1] TYPE II 3-DEHYDROQUINATE HYDRATASE
    3e-04  12%  1a2zA  [c.56.4.1] PYRROLIDONE CARBOXYL PEPTIDASE
    4e-04  12%  1k6iA  [c.2.1.2] NMRA
    4e-04  11%  1lssA  [c.2.1.9] TRK SYSTEM POTASSIUM UPTAKE PROTEIN TRKA HOMOLOG
    5e-04  12%  1p9oA  [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE
    5e-04  15%  1kbzA  [c.2.1.2] DTDP-GLUCOSE OXIDOREDUCTASE
:238

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAERRTALVTGATKGIGLALSKHLQQLGWSVIGVARHAIEGFPGQLLTADLADIQQTDAVLAQVVAASRI
1pwxA           -----TAIVTNVKHFGGMGSALRLSEAGHTVACHDESFLEAFAETYPQLKPMSEQEPAELIEAVTSAYQV
1a27A           ----TVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDPGSLETLQLDVRDSKSVAAARERVTEG-RV
1xg5A           ----RLALVTGASGGIGAAVARALVQQGLKVVGCARTNIEELAAECYRCDLSNEEDILSMFSAIRSHSGV
1bdbA           ----EAVLITGGASGLGRALVDRFVAEGAKVAVLDKSTDHGDNVLGIVGDVRSLEDQKQAASRCVARFGP
1zemA1          ----KVCLVTGAGGNIGLATALRLAEEGTAIAAEASVREKGVEARSYVCDVTSEEAVIGVDSVVRDFGKI
1fjhA           ------IVISGCATGIGAATRKVLEAAGHQIVGIDIRDAE------VIADLSTAEGRKQAIADVLAKCGM
1yb1A           ----EIVLITGAGHGIGRLTAYEFAKLKSKLVLWAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIDV
1n5dA           ----RVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVAGLSPRFHQLDIIDLQSIRALCDFLRKEYGL
1ahhA           ----KCAIITGAGAGIGKEIAITFATAGASVVVSDINAIQQLGGQAFACDITSEQELSALADFAISKLKV
1ae1A           ----TTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKEGLNVEGSVCDLLSRTERDKLMQTVAHVGKL
1nasA           ----AVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSVLAAADLGTEAGVQRLLSAVRELPRPEGQR
2gdzA1          ----KVALVTGAAQGIGRAFAEALLLKGAKVALVDWNQFEPQKTLFIQCDVADQQQLRDTFRKVVDHGRL
1c14A           ----KRILVTGVASKIAYGIAQAMHREGAELAFTYQNEFAAQLGSDIVLDVAEDASIDTMFAELGKVWKF
1snyA           -----SILITGCNRGLGLGLVKALLNLPQHLFTTCRNRKNHSNIHILEIDLRNFDAYDKLVADIEDQGLN
1h5qA           ----KTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAGKEFGVKTKACDVSNTDIVTKTIQQIDADGPI
2c54A1          ----LKISITGAGGFIASHIARRLKHEGHYVIASDWKKEFHLVDLRVMENCLKVTEGVDHVFNLAADMGG
1dhrA           --EARRVLVYGGRGALGSRCVQAFRARNWWVASIDVVEASVIVKMTDSFTEQADQVTAEVGKLLGDQKVD
1spxA           ----KVAIITGSSNGIGRATAVLFAREGAKVTITGRHAERLEEAAGVSEQNVNSVVADVTTDAGQDEILS
1w6uA           ----KVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKSQTGNKVHAIQCDVRDPDMVQNTVSELIKVAHP
1dohA           ----KVALVTGAGRGIGREMAMELGRRGCKVIVNYANAAIKKNGSDAACVKANVGVVEDIVRMFEEAVKL
2ag5A1          ----KVIILTAAAQGIGQAAALAFAREGAKVIATDINLEKYPGIQTRVLDVTKKKQIDQFANEV---ERL
2zqnA1          ----------------------------------------------------------------------
1o5iA           ----KGVLVLAASRGIGRAVADVLSQEGAEVTICARNEELLKRSGHRYVVCDLRKDLDLL---FEKVKEV
1x74A1          ----GLRVVELAGIGPGPHAAMILGDLGADVVRIDRPI---SRDAMLRNRRIVTADLKSDQGLELALKLI
1xseA           MLQGKKVIVTGASKGIGREIAYHLAKMGAHVVVTARSKEALQKVVAIAGSMEDMTFAEEFVAEAGNLMGG
1u7uA           ----LNIMITAGPTREPLDPVRYISDHSSGKMGFALVSGPVSLPTPPFVKRVDVMTALEMEAAVNASQQQ
1u9jA           ---RTRVLILGVNGFIGNHLTERLLREDHYEVYGLLNHPHFHFVEGDISIHSEWI--EYHVKKCDVVLPL
1jr2A           --EDYGGLIFTSPRAVEAAELCLEQNNKTEVWERSLKGNATASLVSKIGLDTEGETCGNAEKLARESSAL
1nytA1          --------------GASRGVLLPLLSLDCAVTITNRTVSRAEE---LAKLFAHTGSIQALSMDELEGHEF
1lu9A1          ----KKAVVLAGTGPVGMRSAALLAGEGAEVVLCGRKLNKRFKVNVTAAETADDASRAEAVKGAH----F
2bgkA1          ----KVAIITGGAGGIGETTAKLFVRYGAKVVIADIADGSPDVISFVHCDVTKDEDVRNLVDTTIAKGKL
1vlwA           ----IVAVLRANSVEEAKEKALAVFEGGVHLIEITFSFLKEKGAIIGAGTVTSVEQCRKAVESGAEIVSP
1vhcA           RELKIVPVIALDNADDILPLADTLAKNGLSVAEITFRSLLRANRPDFLIAAGTVLTAEQVSSGADFVVTP
1di6A           -------VSISDRDKGIPALEEWLTSALTTPFELETRLIP-----------DEQAIIEQTLCELVDEMSC
1h2iA           ---------------------------------QKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINANE
1yxmA1          --QGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPEVNNLVKSTLDTFGKI
1bvrA           ----KRILVSGIDSSIAFHIARVAQEQGAQLVLTRITDRLPAKAPLLELDVQNEEHLASLAGRVTEAIGA
1yo6A1          ----GSVVVTGANRGIGLGLVQQLVKDKNIRHIIATARDVEKATELKSTCDKSLDTFVSKVGEIVGSDGL
1b8pA1          --TPMRVAVTGAAGQICYSLLFRIANGDMLGKDQPIPNEKAQKALQGVMMEIDDCAFPLLAGMTAHADPM
1vm6A3          -------GIVGYSGRMGQEIQKVFSEKGHELVLKVDVNGVEELDSPDVVIDFSSPEALPKTVDLCKKYRA
1zbqA1          ----RVVLVTGAGAGLGLAFAERVNDLGGDFKGVGKGSLARRRGGKAVANYDSVEEGEKVVKTALDAFRI
2ib0A1          ----TIYGYGIVSALSPPGVNFLVADALKQHRHRRDDVIVAAAGYQLPMQVSSAADAARLAVRMENDGAW
1e5lA2          ----------------------------------------------------------KTIEEVHAAGKI
1c3vA1          -------GVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVIDFTHPDVVMGNLENGI
1a9yA           ------VLVTGGSGYIGSHTCVQLLQNGHDVIIPVIERLGGKHPTFVEGDIRNEALMTEILHDHAIDTVI
2fr0A1          -----TVLVTGGTGGVGGQIARWLARRGAPHLLLVSLEALGARTTVAACDVTDRESVRELLGGIGDDVPL
1a4iA1          PIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHTGQPEMVKGEWIKPGAIVIDCGINYKVVDV
2bd0A1          ---KHILLITGAGKGIGRAIALHHPDFEPVLVLSSRTAADLELTDTITADISDMADVRRLTTHIVERYGI
1qp8A1          ----EKVAVLGLG-EIGTRVGKILAALGAQVRGFSRTPKEGPWARAAVCALPLNKHTRGLVKYQHLAXAE
1ujmA           LPEGSLVLVTGANGFVASHVVEQLLEHGYKVRGTARSASKLANLQKRWDAKYPGRFETAVVEDXLKQGAY
1rkxA           ----KRVFVTGHTGFKGGWLSLWLQTMGATVKGYSLTRVADGMQSEIGDIRDQNKLLESIREFQPEIVFH
1bw3A           ATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSGPAGPRGQAACGKCLRVTNPATGAQITARIVDQCGL
2a35A1          ----KRVLLAGATGLTGEHLLDRILSEPTLAKVIAPA---------------RKALAEHPRLDNPVGPLA
1adeA           EKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKYHNFQLVNYYKAEAVDYQKVLDDTMAVADILVD
1hdoA           MA-VKKIAIFGATGQTGLTTLAQAVQAGYEVTVLVRDSLPSEGPRPAHVVVGDVLQAADVDKTVAGQDAV
1a4uA           ----------------------------------------------------------------------
1i24A           ----SRVMVIGGDGYCGWATALHLSKKNYEVCIVDNLESLTPIASIHDRISRWKALTGKSIELYVGDICF
2joeA1          -------------KEESKKFSANLNGTEIAITYVVLKQSSETKIQFASIGATTKEDAAKTLEPLSAKYNI
1qycA           -GSRSRILLIGATGYIGRHVAKASLDLGHPTFLLVRES-TASSNSEKAQLLESFKASGDHASLVEAVKNV
2bkaA1          ----KSVFILGASGETGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYASFQGH
1gu7A2          ----------------------------------------------------------------------
1e1cA2          ----LLAKMGQDGHDRGQKVATAYADLGFDVDVGPLAVEADVHVVGVSSLAGGHLTLVPALRKELDKGRP
2gdtA1          ----RDVLVRGFGDSVEEALSEAREHLKNGTCGLVELEKGVLPQLEQPYVFIKRSTNHGHKVVELVAEMD
1pjqA1          ----RDCLIVGGG-DVAERKARLLLEAGARLTVNALTMLTLVEGPFDETLAIAATDDDTVNQRVSDAESR
1ftrA1          --------------EIEDTFAEAFEAKMARVLITAASHGFGTSVIMCPAEAGIDCGYVPPEETPDGRPGV
1qorA2          ----EQFLFHAAAGGVGLIACQWAKALGAKLIGTVGTAQKAQSALKAGAW-QVINYREEDLVERLKEITG
1sb8A           -AQPKVWLITGVAGFIGSNLLETLLKLDQKVVGLVRSLVSEKQWSNFKFIQGDIRNLDDCNN---ACAGV
1edzA1          ----KKCIVINRSEIVGRPLAALLANDGATVYSVDVNNIQKFTRGESLKLNKHHVEDLGEYSEDLLKKCS
1bxkA           ----RKILITGGAGFIGSALVRYIINETSDAVVVLMSLAPVAQSERFAFEKVDICDRAE-LARVFTEHQP
2hjsA1          --QPLNVAVVGATGSVGEALVGLLDERDFPLHRLHLLASAESAGQRGDVDSFDFSSVG------------
1vl0A           -------LITGANGQLGREIQKQLKGKNVEVIPTDVQDL----------DITNVLA----VNKFFNEKKP
1bsvA           ---KQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTR---------------------------------
2b69A1          ---RKRILITGGAGFVGSHLTDKLXXDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHD-VVEPLYIEV
1npdA1          ----KTXVLLGAG-GASTAIGAQGAIEGLKEIKALAFAQRVNENTDCVVTVTDLADQQAFAEAL---ASA
1aorA1          ----QTGVYPYAYEQSGEAMAAKYLVRNKPCYACPIG---------------------------------
1db3A           ----KVALITGVTGQDGSYLAEFLLEKGYEVHGIKRPKFHLHYGDLSDTSNLTRILREVQPDEVYNLGAM
1eq2A           ------IIVTGGAGFIGSNIVKALNDKGITDILVVDN---------------------------------
1gefA           -------------AQAERELIKLLEKHGFAVVRSAGSKKVDLCIEVKVTKKDHLYVGKRDMGRLIEFSRR
1cjcA1          ----DTAVILGQG-NVALDVARILLTPPDHLEKTDITQSRVKTVWIVGRRGPLQVAFTIKELREMIQLGT
1orrA           -------LITGGCGFLGSNLASFALSQGIDLIVFDNL---------------------------------
1d0iA           LANAPIMILNGP----NLNL---LGQRQPEIYGSDTLAVKAAAAHGGTVDFRQSNHEGELVDWIHEANHC
1a2zA           ----KKVLITGFEPFGGDSKNPTEQIAKYFDRKQIGNAMVYGRVLPVSVKRATIELKRY-----LEEIKP
1k6iA           --QKKTIAVVNATGRQAASLIRVAAAVGHHVRAQV-HSLKGLI----AEELQAIPNVTLFQGPL----LN
1lssA           -------IIIAGIGRVGYTLAKSLSEKGHDIVLIDIDKDICKIDALVINGDCTKIKTLEDAGIEDADMYI
1p9oA           EARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARS---AFPYAHRFPPQT----------------
1kbzA           -----NILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVNAAA---


                         .         .         *         .         .         .         .:140
query           DAVINNAGIALPQKLESLDLPSLQTVFDLNVRAAVQVTQACLPSLKQSPAGRIVNVCSRAIHGARDRTSY
1pwxA           DVLVSNDIFAPEFQIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGHIIFISATPFGPWKELSTY
1a27A           DVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGRVLVTGSVGLMGLPFNDVY
1xg5A           DICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVGHIININSHRVLPLSVTHFY
1bdbA           NAGIWDYSTALVDLPEESLDAAFDEVFHINVKGYIHAVKACLPALVASRGNVIFTISNAGFYPNGGGPLY
1zemA1          DFLFNNAGYQAFAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYGRIVNTASMAVKGPPNMAAY
1fjhA           DGLVLCAGLGPQTKV-------LGNVVSVNYFGATELMDAFLPALKKGHQPAAVVISSVAAHLAFDKLAY
1yb1A           SILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAHVSVPFLLAY
1n5dA           DVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQ--GRVVNVSSEGVRALNECSPE
1ahhA           DILVNNAGGGGPKPFDM-PMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTISMAAENKNINMTSY
1ae1A           NILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSIAGFSALPSVSLY
1nasA           LLLINNAATLSKGFLNVNDLAEVNNYWALNLTSMLCLTSGTLNAFQDGLSKTVVNISSCALQPYKGWGLY
2gdzA1          DILVNNAGVNNE--------KNWEKTLQINLVSVISGTYLGLDYMSKGEGGIIINMSSLALMPVAQQPVY
1c14A           DGFVHSIGFAPGDQLDGDYVNAVTIAHDISSYSFVAMAKACRSMLNPG--SALLTLSYGAERAIPNYNVM
1snyA           VLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIXLAKACLPLLKKAAKANESQPXGVG-RAAIINXSY
1h5qA           SGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKQQKGSIVVTSSSLNGSLTQVFY
2c54A1          MGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQLETTNVSLKESDAWPAEPQDAY
1dhrA           AILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLK---EGGLLTLAKAALDGTPGMIGY
1spxA           TTLGKFGKLDILVNNAGQSIESYDATLNLNLRSVIALTKKAVP-HLSSTKGEIVNISSIALHATPDFPYY
1w6uA           NIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKQLIKAQKGAAFLSITTIETGSGFVVPS
1dohA           DIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLILMGSITGQAKAVPKHAVY
2ag5A1          DVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGNIINMSSSSVKGVVNRCVY
2zqnA1          ------------------------KFFYIK---SELNGKVLDIEGQNPAPGSKIITWDKKGPTAVNQLWY
1o5iA           DILVLNAGGPKAGFFDELTNEDFKEAIDSLFLNMIKIVRNYLPAMKEKGWGRIVAITSFSVSPIENLYTS
1x74A1          AKADVLIEGYRPGVTERLGLGPEECAKVNDRLIYARMTGWGQTGPRSQQAGHDINYISLNILHAIGRGDE
1xseA           DMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSIAVVSSVAGKITYPLIAPY
1u7uA           NIFIGCAAVADYRAALTIKMVKNPDIVAGVAALK--DHRPYVVGFAAETNNVEEYARQKIRKNLDLICAN
1u9jA           VAATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEVYGMCSDKYFDENLIVGPVNKPRWIY
1jr2A           PLLFPCGNLKREILPKALSITVYQTVAHPGIQGNLNSYYSQQGVPASITFFSPSGLTYSLHIQELSGDNI
1nytA1          DLIINATSSGISGDIPAIPSSLIHPGIYCYDMFYQKGKTPFLAWCEQRGSKRNADGLGMLVAAAHAFLLW
1lu9A1          VFTAGAIGLELLPQAAWQNESSIEIVADYNAQPPLGIGGIDATDKGKEYGGKRAFGALKLKLHRACIAKL
2bgkA1          DIMFGNVGVLSTTSILEAGNEDFKRVMDINVYGAFLVAKAARVMIPAKKGSIVFTASISSFTAEGVSHVY
1vlwA           HLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILEVVGPQFVKAMKGPFPNVKFVPTGGVNLDNVC
1vhcA           GLNPKIVKLCQDLNFPITPGVNNPXAI-----------EIALEXGISAVKFFPAEASGVKXIKALLGPYA
1di6A           HLVLTTGGTGPARRDVTPD--ATLAVADREMPGFGEQMRQISL--HFVPTAILSRQVGVIRKQALILNLP
1h2iA           MFGYNGWAHSITQ-QNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSALSLEKARKEAV
1yxmA1          NFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHS
1bvrA           GIGFMPQTGMGINPFFDAPYADVSKGIHISAYSYASMAKALLPIMNPGGSIVG--MDFDPSRAMPAYNWM
1yo6A1          SLLINNAGVLLSYGNTEPNRAVIAEQLDVNTTSVVLLTQKLLPLLKNAASAAVITISSGLGSITFPVLAY
1b8pA1          TAFKDADVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVASRN--IKVLVVGNPANTNAYMKSAP
1vm6A3          GLVLGTTALKEEHLQMLRELSVQAYSRTVFAIGALKAAEFLVGKDPGMYSFEEVI---------------
1zbqA1          DVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQAN
2ib0A1          RAVVEHAETADDRVFASTALTAVMATRWNRVLGAWPITAAF-----------------------------
1e5lA2          KTFLSYCGG---LPAPESSDNPLGYKFSWSSRGVLLALRNAASFYKD---GKVTNVAGPELMATA-KPYF
1c3vA1          HAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFTSFVPGVLLAVRRIAERPGLTVG------------
1a9yA           HFAGLKAVGESVQKPLEYYDNNVNGTLRLISAMRAANVKNFIFSSAATVYGDQPKIPYESFPTGTPQSPF
2fr0A1          SAVFHAAATLDDGTVDTLTGERIERASRAKVLGARNLHELTRE---LDLTAFVLFSSFASAFGAPGLGGY
1a4iA1          AYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRF--------------------------------
2bd0A1          DCLVNNAGVGRFGALSDLTEEDFDYTMNTNLKGTFFLTQALFALMERQHSGHIFFITSVAATKAFHSSIY
1qp8A1          DAVFVNVGRAEVLDRDGVLRILKERPQFIFASDVWWGRNDFAKDAEFFSLPNVVATPW------------
1ujmA           DEVIKGAAGVAHIASVVSFSNKYDEVVTPAIGGTLNALRAAAAIPKPNVEGIYLDEKSWNLESIDKLWVY
1rkxA           MAAQPLVRLSYSEPVETYSTNVMGTVYLLEAIRHVGGVKAVVNITSDKCYDNKEWIWGRENEAMGGYDPY
1bw3A           DLDWDTVFTKID----TNGIGYQQGHLNVNYQF-------------------------------------
2a35A1          ELLPQLDGSIDTAFCCLGTTIKEAGSEEAFRAVDFDLPLAVGKRALEMGARHYLVVSALGADA-KSSIFY
1adeA           VSDLLDQARQRGDFVM----------FEGAQGTLLDIDHGTYPYVTSS-NTTAGGVATGSLGPRYVDYVL
1hdoA           IVLLGTRN------------------DLSPTTVMSEGARNIVAAMKAHGVDKVVACTS--AFLLWDPTKV
1a4uA           --------------------------------------------------------SVTGFNAIHQVPVY
1i24A           KSFEPDSVVHFGEQRSAPYSMIDRSRAVYTQHNNVIGTLNVLFAIKEFGEECHLVKLGTMEYGTPNIDIE
2joeA1          AGVEEKLTYAQENVTIDMEKVDFKALQGISGINVSAEDAKKGITMAQM----------------------
1qycA           DVVISTVGSLQIESQVNIIKAIKEVGTVKRFFPSEFGNDVDNV------------------HAVEPAKSV
2bkaA1          DVGFCCLGTTRG-----------KAGAEGFVRVDRDYVLKSAELAKAGGCKHFNLLSSKGADKSSNFLYL
1gu7A2          ----NCVGGKSSTGIA-RKLNNNGLMLTYGGMSFQPVTIPTSLYIFKNFTSAGFWVTELLKNN---KELK
1e1cA2          DILITVGGVIPEQDFDELRKDGAVEIYTPGTV-IPESAISLVKKLRAS----------------------
2gdtA1          GIQYGRSGITLGVPHVGETPIAYRNVL-LRK---------------------------------------
1pjqA1          RIFCNVVDAPKAASF-------------------------------------------------------
1ftrA1          TIMIGHN------DEDELKEQLLDRIGQCVMTAPTASAFDAMPEAEKEDEDRV-----------------
1qorA2          GKKVRVVYDSVGRDTWERSLDCLQRRGLMVSFGNSSGAVTGVNLGILNQKGSYVTRPSQGYITTREELTE
1sb8A           DYVLHQAALG--------SVPRSINDPITSNATNIDGFLNMLIAARDAKVQSFTYAASSSTYGGKPLSPY
1edzA1          SDVVITGVPSENYKFPTEYIKEGAVCINFACTKNFSDDVKEKASLYV-PMTGKVTI--------------
1bxkA           DCVMHLAAESHVDRSIDGPAAFIETNIVYTLLEAARAYWNALTEDKKS-AFRFHHISTDEVYG-------
2hjsA1          ----------------------------------------------------------------------
1vl0A           NVVINCAAHTAVDKCE--EQYDL--AYKINAIGPKNLAAAA-----------------------------
1bsvA           ----------------------------------------------------------------------
2b69A1          DQIYHLASPASP--------PNYXYNPIKTLKTNTIGTLNXLGLAKRVGARLLLASTSEVYGD-------
1npdA1          DILTNGTKVGXKPLENESLVNDISLLHPGLLVTECVYNPHXTKLLQQAQQCKTIDGYGXLLW--------
1aorA1          ----------------------------------------------------------------------
1db3A           SHVAVS--FESPEYTADVDAMGTLRLLEAIRFLGLEKKTRFYQASTSELYGLVQEIPQKETTPFYPRSPY
1eq2A           ----------------------------------------------------------------------
1gefA           FGGIPVLAVKFLNGWRFIEVSPKIEKFVFTPSSGVSLEV-------------------------------
1cjcA1          RPMLDPADFLGLQDRIKEAARPRKRLMELLLRTAT-EKPGVEEAARRASASRAWGLRFF-----------
1orrA           ----------------------------------------------------------------------
1d0iA           GIVINPAAYSHTSVAILDALNTCDPVVEVHISNIHQREPF---------RHHSYVSQRDGVVAGCGVQGY
1a2zA           EIVINLGLAPTYSNITVERIAVNIIDARIPDNDGYQPIDEK-----------------------------
1k6iA           NVPLMDTLFEGAHLAFI----NTTSQAGDEIAIGKDLADAA-KRAGTIQHYIYSSMPDHSLYGPWPAVPM
1lssA           AVTGKEEVNLMS--------SLLAKSYGINKTIARISEIEYKDVFERLGVDVVVSPELIAANYIEKLI--
1p9oA           ----------------------------------------------------------------------
1kbzA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AAAKSALIGVTRTWALELAPLGITANAVAPGPVETELFRLTHPVGSDEEKRILATIPMQRLGKPEEVASL
1pwxA           TSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDFYPTEPWKTNPVAHVKKVTALQRLGTQKELGEL
1a27A           CASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEIHTFHRFYQYLAHSKQVFREAAQNPEEVAEV
1xg5A           SATKYAVTALTEGLRQELAQTHIRATCISPGVVETQFAFKLH------DKDPEKAAATYECLKPEDVAEA
1bdbA           TAAKHAIVGLVRELAFELAP-YVRVNGVGSGGINSDLRG--PSSLGPLADMLKSVLPIGRMPEVEEYTGA
1zemA1          GTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWLQAKVGSQYFQQMIGSVPMRRYGDINEIPGV
1fjhA           AGSKNALTVAVRKRAAAWGEAGVRLNTIAPGAFVP---------------------PMGRRAEPSEMASV
1yb1A           CSSKFAAVGFHKTLTDELAALGVKTTCLCPNFVNTGFIK-------------NPSTSLGPTLEPEEVVNR
1n5dA           LQQKFKSETITEEELVGLAGDKILLNACCPGWVRTDMGGPKAP----KSPEVGAETPVYLALLPSDAEGP
1ahhA           ASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALK--SVITPEIEQKMLQHTPIRRLGQPQDIANA
1ae1A           SASKGAINQMTKSLACEWAKDNIRVNSVAPGVILQK----------EEIDNFIVKTPMGRAGKPQEVSAL
1nasA           CAGKAARDMLYQVLAAE--EPSVRVLSYAPGPLDNDMQQLARETSKDPRSKLQKLKSDGALVDCGTSAQK
2gdzA1          CASKHGIVGFTRSAALNLMNSGVRLNAICPGFVNTAILE---SIEKEEKDHIKDMIKYYGILDPPLIANG
1c14A           GLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKD-FRKMLAHCEAVTPIRRTVTIEDVGNS
1snyA           RTSKSALNAATKSLSVDLYPQRIXCVSLHPGWVKTDXG------------------GSSAPLDVPTSTGQ
1h5qA           NSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQT---AHMDKKIRDHQASNIPLNRFAQPEEMTGQ
2c54A1          GLERLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKGGREKAPAAFRKAQTSTDRFEMWG--------
1dhrA           GMAKGAVHQLCQSLAGKGMPSGAAAIAVLPVTLDTPMNRKSMP-----------EADFSSWTPLEFLVET
1spxA           SIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATGFY--------STMATMKECVPAGVMGQPQDIAEV
1w6uA           ASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIK------TLDPTGTFEKEMIGRIPCGRLGTVEELANL
1dohA           SGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHENLSNEEVDEYAAVQWSPLRRVGLPIDIARV
2ag5A1          STTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQERIQARGNPENDFLKRQKTGRFATAEEIAML
2zqnA1          TDQQGVIRSKLNDFAIDASHEQIETQPFDPNNPKRAWI---VSGNTIAQLSDRDIVLDIIKSDKEAGAHI
1o5iA           NSARMALTGFLKTLSFEVAPYGITVNCVAPGWTETERVK--ELLSEEKKKQVESQIPMRRMAKPEEIASV
1x74A1          RPVPPLNLVGDFGGGSMFLLVGILAALWERQSSGKGQVVDAAMVDGWAMRATGMWTDTRGANMLDGGAPY
1xseA           SASKFALDGFFSTLRSEFLVVNVSITLCILGLIDTETA-----------IKATSGIYLGPASPKEECALE
1u7uA           SDNNALHLFWQDGDKV------------------------------------------------------
1u9jA           SVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNILNLVEGSPIKLIDGGKQKRCFTDIRDGIEA
1jr2A           DQIKFAAIGPTTAR--ALAAQGLPVSCTAESPTPQALAT-------------------------------
1nytA1          HGVLPDVEPVIKQLQEELS---------------------------------------------------
1lu9A1          FESSEGVFDAEEIYKLA-----------------------------------------------------
2bgkA1          TATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTFGVDSSRVEELAHQAANLKGTLLRAEDVADA
1vlwA           EWFKAGVLAVGVGSALKGTPDEVREKAKAFV---------------------------------------
1vhcA           QLQIXPTGGIGLHNIRDYLAIPNIVACGGSWFVEKKLIQ-------------------------------
1di6A           GQPKSIKETLEGVKDAEGNVVVHGIFASVPYCIQLLE---------------------------------
1h2iA           TDGLKRARSFGNALGNCILD-KDYLRSLNKLPRQLPLEV---DLTKAKRQDLEPSVEEARYNSC------
1yxmA1          GAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQFFEGSFQKIPAKRIGVPEEVSSV
1bvrA           TVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAGAQIQLLEEGWDQRAPIGWNMKDATPVAKT
1yo6A1          RMSKAAINMFGRTLAVDLKDDNVLVVNFCPGWVEQSTAELISSFNKLDNSHNGR--FFMRNLKPYE----
1b8pA1          SLPAKNFTAM------------------------------------------------------------
1vm6A3          ----------------------------------------------------------------------
1zbqA1          YSAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQT-------------VMPEDLVEALKPEYVAPL
2ib0A1          ----------------------------------------------------------------------
1e5lA2          IYPGFAFVAYPNRDSTPYKERIPEADNIVRGTLRYQGFPQFIKVLVDIFLSDEEQPFLKEAIPWKEATQK
1c3vA1          ----------------------------------------------------------------------
1a9yA           GKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHPSGDM-GEDPQGIPNNLMPYIAQVAVGRRDSLA--
2fr0A1          APGNAYLDGLAQQRRSDGLPATAVAWGTWAGSGMAEGPV-----------ADRFRRHGVIEMPPETACRA
1a4iA1          ----------------------------------------------------------------------
2bd0A1          CMSKFGQRGLVETMRLYARKCNVRITDVQPGAVYTPMW------------GKVDDEMQALMMMPEDIAAP
1qp8A1          ----------------------------------------------------------------------
1ujmA           AASKTEAELAAWKFXDENKP-HFTLNAVLPNYTIGTIFDPETQSGS------------------------
1rkxA           SNSKGCAELVTSSYRNSFFNPANYGQHGTAVAT-------------------------------------
1bw3A           ----------------------------------------------------------------------
2a35A1          NRVKGELEQALQEQG------WPQLTIARPSLL----------FGPREEFRLAEILAAPIAGKYHGIE--
1adeA           GILKAYSTRVGA------------------GPFPTEL--------FDETGEFLCKQ--------------
1hdoA           PPRLQAVTDDHIRMHKVLRESGLKYVAVMPPHIGDQPLTGAYTVTLDGR-------GPSRVISKHDLGHF
1a4uA           SASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVH-TFNSWLDVEPRVAELLLSHPTQTSEQCGQN
1i24A           EGYITITHNGRTDTL-------------------------------------------------------
2joeA1          ----------------------------------------------------------------------
1qycA           FEVKAKVRRAIEAEGIPYTYVSSNCFAGYFLRSLAQAGL--TAPPRDKVVILGDGNARVVFVKEEDIGTF
2bkaA1          QV-------KGEVEAKVEELKFDRYSVFRPGVLLCDRSRPGEWLVRKFFGSLPDSWASGHSVPVVTVVRA
1gu7A2          TSTLNQIIAWYE----------------------------------------------------------
1e1cA2          ----------------------------------------------------------------------
2gdtA1          ----------------------------------------------------------------------
1pjqA1          ----------------------------------------------------------------------
1ftrA1          ----------------------------------------------------------------------
1qorA2          ASNE-LFSLIAS----------------------------------------------------------
1sb8A           AVTKYV----------------------------------------------------------------
1edzA1          ----------------------------------------------------------------------
1bxkA           ----------------------------------------------------------------------
2hjsA1          ----------------------------------------------------------------------
1vl0A           ----------------------------------------------------------------------
1bsvA           ----------------------------------------------------------------------
2b69A1          ----------------------------------------------------------------------
1npdA1          ----------------------------------------------------------------------
1aorA1          ----------------------------------------------------------------------
1db3A           AVAKLYAYWITVNYR-------------------------------------------------------
1eq2A           ----------------------------------------------------------------------
1gefA           ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1orrA           ----------------------------------------------------------------------
1d0iA           VFGVERIAA-------------------------------------------------------------
1a2zA           ----------------------------------------------------------------------
1k6iA           WAPKFTVENYVRQLGLP-----------------------------------------------------
1lssA           ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1kbzA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ISYLISDGASFVTxxxxxxxxxxxxxxx
1pwxA           VAFLASGSCDYLT---------------
1a27A           FLTALKPTLRYFT---------------
1xg5A           VIYVLSTPAHIQI---------------
1bdbA           YVFFATGDAAPAT---------------
1zemA1          VAFLLGDDSSFMT---------------
1fjhA           IAFLMSPAASYVH---------------
1yb1A           LMHGILTEQKMI----------------
1n5dA           HGQFVTDKKVVEW---------------
1ahhA           ALFLCSPAASWVS---------------
1ae1A           IAFLCFPAASYIT---------------
1nasA           LLGLLQK-DTFQS---------------
2gdzA1          LITLIEDDA-------------------
1c14A           AAFLCSDLSAGIS---------------
1snyA           IVQTISKLGEKQN---------------
1h5qA           AILLLSDHATYMT---------------
2c54A1          ----------------------------
1dhrA           FHDWITGNKRPNS---------------
1spxA           IAFLADKTSSYII---------------
1w6uA           AAFLCSDYASWIN---------------
1dohA           VCFLASNDGGWVT---------------
2ag5A1          CVYLASDESAYVT---------------
2zqnA1          CAWKQHGGPN------------------
1o5iA           VAFLCSEKASYLT---------------
1x74A1          YDTYECADGRYVA---------------
1xseA           IYYVGSRWVPYLL---------------
1u7uA           ----------------------------
1u9jA           LYRIIENAGNRCD---------------
1jr2A           ----------------------------
1nytA1          ----------------------------
1lu9A1          ----------------------------
2bgkA1          VAYLAGDESKYVS---------------
1vlwA           ----------------------------
1vhcA           ----------------------------
1di6A           ----------------------------
1h2iA           ----------------------------
1yxmA1          VCFLLSPAASFIT---------------
1bvrA           VCALLSDWLPATT---------------
1yo6A1          ----------------------------
1b8pA1          ----------------------------
1vm6A3          ----------------------------
1zbqA1          VLWLCHE-SCEEN---------------
2ib0A1          ----------------------------
1e5lA2          IVKASSASEQDIV---------------
1c3vA1          ----------------------------
1a9yA           ----------------------------
2fr0A1          LQNALDRAEVCPI---------------
1a4iA1          ----------------------------
2bd0A1          VVQAYLQPSRTVV---------------
1qp8A1          ----------------------------
1ujmA           ----------------------------
1rkxA           ----------------------------
1bw3A           ----------------------------
2a35A1          ----------------------------
1adeA           ----------------------------
1hdoA           MLRCLTTDE-------------------
1a4uA           FVKAIEAN--------------------
1i24A           ----------------------------
2joeA1          ----------------------------
1qycA           TIKAVDDPRT------------------
2bkaA1          MLNNVVRPRD------------------
1gu7A2          ----------------------------
1e1cA2          ----------------------------
2gdtA1          ----------------------------
1pjqA1          ----------------------------
1ftrA1          ----------------------------
1qorA2          ----------------------------
1sb8A           ----------------------------
1edzA1          ----------------------------
1bxkA           ----------------------------
2hjsA1          ----------------------------
1vl0A           ----------------------------
1bsvA           ----------------------------
2b69A1          ----------------------------
1npdA1          ----------------------------
1aorA1          ----------------------------
1db3A           ----------------------------
1eq2A           ----------------------------
1gefA           ----------------------------
1cjcA1          ----------------------------
1orrA           ----------------------------
1d0iA           ----------------------------
1a2zA           ----------------------------
1k6iA           ----------------------------
1lssA           ----------------------------
1p9oA           ----------------------------
1kbzA           ----------------------------