[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF08812.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2r6gG1.bssp"
#ERROR : Can't open dsspfile "3dhwA1.bssp"
#ERROR : Can't open dsspfile "2onkC1.bssp"

## Summary of PDB Search
:316
    1e-11  12%  2r6gG1 [f.58.1.1] MALTOSE TRANSPORT SYSTEM PERMEASE PROTEIN MALG
    6e-08  15%  3dhwA1 [f.58.1.1] D-METHIONINE TRANSPORT SYSTEM PERMEASE PROTEIN
    3e-07  15%  2onkC1 [f.58.1.1] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, PERMEASE C:1
:316

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2r6gG1          ----------------------------------------------------------------------
3dhwA1          ----------------------------------------------------------------------
2onkC1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxRPVMSEVSVAVVNSVRLAAVATLIGFTFGCLFGFVAGYLRDSVPDRVASFLSVLGVS
2r6gG1          -------------TPPPFPVLLWLWNSVKVAGISAI----GIVALSTTCAYAFARMRFPGKATLLKG-ML
3dhwA1          ----------------MWLLVRGVWETLAMTFVSGFFGFVIGLPVGVLLYVTR-PGQIIANAKLYRTVSA
2onkC1          ----------------------VVLTTYYAALISTLIAVIFGTPLAYILARKSFPGKSVVEGIVDLPVVI


                         +         .         .         .         .         *         .:210
query           IPHYWLGMVLVIAFSVLLGWLPATGAGPNGSGDWGWDWEHIQYMLLPAVTMSVIPMGIVARTIRALVAEI
2r6gG1          IFQMFPAVLSLVALYALFDRL------------GEYIPFIGLNTHGGVIFAYLGGIALHVWTIKGYFETI
3dhwA1          IVNIFRSIPFIILLVWMIPFTR-------------VIVGTSIGLQAAIVPLTVGAAPFIARMVEN-ALLE
2onkC1          PHTVAGIALLV-------------VFGSSGLIGSFSPLKFVDALPGIVVAMLFVSVPIYINQAKE-GFAS


                         .         .         .         +         .         .         .:280
query           LSNEFIAGLRARGLSDLAVFRHVVKNVTPTALSVMGLQLGYLLGGSILIETVFSWPGTGFLLNSAIFQRD
2r6gG1          -DSSLEEAAALDGATPWQAFRLVLPLSVPILAVVFILSFIAAITEVPVASLLLRDVYTLAVGMQQYLNPQ
3dhwA1          IPTGLIEASRAMGATPMQIVKVLLPEALPGLVNAATITLITLVG--------------------------
2onkC1          VDVRLEHVARTLGSSPLRVFFTVSPLSVRHIVAGAIMSWARGISEFGAVVVIYYPMIAPTLIYERYLSEG


                         .         *         .         .         .         .         +:350
query           FPLLQGTILVLAVFFVMLNLLVDALQTLFDPRIQRx
2r6gG1          NYLWGDFAAAAVMSALPITIVFLLAQRWLVNGLTA-
3dhwA1          ------------------------------------
2onkC1          LSAAMAAILILLSLAVFVAL----------------