[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF08950.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1t07A.bssp"

## Summary of PDB Search
:114
    1e-32  46%  1t07A  [d.279.1.1] HYPOTHETICAL UPF0269 PROTEIN PA5148
:114

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxARMVHCIKLNKEAEGLDFPPLPGDLGKKIWQNVSKEAWAGWLKHQT
1t07A           ------------------------SRTVXCRKYHEELPGLDRPPYPGAKGEDIYNNVSRKAWDEWQKHQT


                         .         .         *         .         .         .         .:140
query           MLINENRLNMADPRARQYLIKQTEKYFFGDxxxxxxxxxxxxxx
1t07A           XLINERRLNXXNAEDRKFLQQEXDKFLSGE--------------