[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF09080.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1pwxA.bssp"
#ERROR : Can't open dsspfile "1a27A.bssp"
#ERROR : Can't open dsspfile "1bdbA.bssp"
#ERROR : Can't open dsspfile "1nasA.bssp"
#ERROR : Can't open dsspfile "1zemA1.bssp"
#ERROR : Can't open dsspfile "1ahhA.bssp"
#ERROR : Can't open dsspfile "2gdzA1.bssp"
#ERROR : Can't open dsspfile "1xg5A.bssp"
#ERROR : Can't open dsspfile "1dohA.bssp"
#ERROR : Can't open dsspfile "1h5qA.bssp"
#ERROR : Can't open dsspfile "1yb1A.bssp"
#ERROR : Can't open dsspfile "1x74A1.bssp"
#ERROR : Can't open dsspfile "1w6uA.bssp"
#ERROR : Can't open dsspfile "1c14A.bssp"
#ERROR : Can't open dsspfile "1o5iA.bssp"
#ERROR : Can't open dsspfile "2ag5A1.bssp"
#ERROR : Can't open dsspfile "2zqnA1.bssp"
#ERROR : Can't open dsspfile "2c54A1.bssp"
#ERROR : Can't open dsspfile "1n5dA.bssp"
#ERROR : Can't open dsspfile "1e5lA2.bssp"
#ERROR : Can't open dsspfile "1zbqA1.bssp"
#ERROR : Can't open dsspfile "1ae1A.bssp"
#ERROR : Can't open dsspfile "1dhrA.bssp"
#ERROR : Can't open dsspfile "1jr2A.bssp"
#ERROR : Can't open dsspfile "1spxA.bssp"
#ERROR : Can't open dsspfile "1fjhA.bssp"
#ERROR : Can't open dsspfile "1u9jA.bssp"
#ERROR : Can't open dsspfile "1nytA1.bssp"
#ERROR : Can't open dsspfile "1snyA.bssp"
#ERROR : Can't open dsspfile "1bvrA.bssp"
#ERROR : Can't open dsspfile "1h2iA.bssp"
#ERROR : Can't open dsspfile "1yxmA1.bssp"
#ERROR : Can't open dsspfile "1u7uA.bssp"
#ERROR : Can't open dsspfile "2bgkA1.bssp"
#ERROR : Can't open dsspfile "1lu9A1.bssp"
#ERROR : Can't open dsspfile "1xseA.bssp"
#ERROR : Can't open dsspfile "1d0iA.bssp"
#ERROR : Can't open dsspfile "1vhcA.bssp"
#ERROR : Can't open dsspfile "1yo6A1.bssp"
#ERROR : Can't open dsspfile "1qp8A1.bssp"
#ERROR : Can't open dsspfile "1a4uA.bssp"
#ERROR : Can't open dsspfile "2fr0A1.bssp"
#ERROR : Can't open dsspfile "2bd0A1.bssp"
#ERROR : Can't open dsspfile "1gu7A2.bssp"
#ERROR : Can't open dsspfile "1vlwA.bssp"
#ERROR : Can't open dsspfile "2joeA1.bssp"
#ERROR : Can't open dsspfile "1a4iA1.bssp"
#ERROR : Can't open dsspfile "1qorA2.bssp"
#ERROR : Can't open dsspfile "1di6A.bssp"
#ERROR : Can't open dsspfile "1b8pA1.bssp"
#ERROR : Can't open dsspfile "1adeA.bssp"
#ERROR : Can't open dsspfile "1i24A.bssp"
#ERROR : Can't open dsspfile "1c3vA1.bssp"
#ERROR : Can't open dsspfile "1a9yA.bssp"
#ERROR : Can't open dsspfile "1rkxA.bssp"
#ERROR : Can't open dsspfile "1hdoA.bssp"
#ERROR : Can't open dsspfile "1ftrA1.bssp"
#ERROR : Can't open dsspfile "1e1cA2.bssp"
#ERROR : Can't open dsspfile "1vm6A3.bssp"
#ERROR : Can't open dsspfile "1edzA1.bssp"
#ERROR : Can't open dsspfile "2ib0A1.bssp"
#ERROR : Can't open dsspfile "1bw3A.bssp"
#ERROR : Can't open dsspfile "2bkaA1.bssp"
#ERROR : Can't open dsspfile "2auwA2.bssp"
#ERROR : Can't open dsspfile "2a35A1.bssp"
#ERROR : Can't open dsspfile "1cjcA1.bssp"
#ERROR : Can't open dsspfile "1npdA1.bssp"

## Summary of PDB Search
:264
    3e-40  22%  1pwxA  [c.2.1.2] HALOHYDRIN DEHALOGENASE
    3e-39  21%  1a27A  [c.2.1.2] 17-BETA-HYDROXYSTEROID-DEHYDROGENASE
    1e-36  23%  1bdbA  [c.2.1.2] CIS-BIPHENYL-2,3-DIHYDRODIOL-2,3-DEHYDROGENASE
    2e-33  19%  1nasA  [c.2.1.2] SEPIAPTERIN REDUCTASE
    5e-32  29%  1zemA1 [c.2.1.2] XYLITOL DEHYDROGENASE A:3 -- 262
    9e-32  30%  1ahhA  [c.2.1.2] 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
    1e-31  26%  2gdzA1 [c.2.1.2] NAD+-DEPENDENT 15-HYDROXYPROSTAGLANDIN A:3 -- 256
    4e-30  22%  1xg5A  [c.2.1.2] ARPG836
    2e-28  20%  1dohA  [c.2.1.2] TRIHYDROXYNAPHTHALENE REDUCTASE
    5e-28  22%  1h5qA  [c.2.1.2] NADP-DEPENDENT MANNITOL DEHYDROGENASE
    4e-27  25%  1yb1A  [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE TYPE XI
    3e-25  10%  1x74A1 [c.123.1.1] 2-METHYLACYL-COA RACEMASE A:2 -- 360
    1e-24  24%  1w6uA  [c.2.1.2] 2,4-DIENOYL-COA REDUCTASE, MITOCHONDRIAL
    6e-24  16%  1c14A  [c.2.1.2] ENOYL REDUCTASE
    6e-24  27%  1o5iA  [c.2.1.2] 3-OXOACYL-(ACYL CARRIER PROTEIN) REDUCTASE
    1e-23  21%  2ag5A1 [c.2.1.2] DEHYDROGENASE/REDUCTASE (SDR FAMILY) MEMBER 6 A:1
    2e-23   7%  2zqnA1 [b.42.2.1] 29-KDA GALACTOSE-BINDING LECTIN A:131 -- 260
    4e-23   5%  2c54A1 [c.2.1.2] GDP-MANNOSE-3', 5'-EPIMERASE A:13 -- 374
    2e-22  20%  1n5dA  [c.2.1.2] CARBONYL REDUCTASE/20BETA-HYDROXYSTEROID
    5e-22  14%  1e5lA2 [d.81.1.2] SACCHAROPINE REDUCTASE A:125 -- 391
    6e-22  27%  1zbqA1 [c.2.1.2] 17-BETA-HYDROXYSTEROID DEHYDROGENASE 4 A:3 -- 304
    4e-21  26%  1ae1A  [c.2.1.2] TROPINONE REDUCTASE-I
    4e-21  18%  1dhrA  [c.2.1.2] DIHYDROPTERIDINE REDUCTASE
    1e-20   8%  1jr2A  [c.113.1.1] UROPORPHYRINOGEN-III SYNTHASE
    1e-20  23%  1spxA  [c.2.1.2] SHORT-CHAIN REDUCTASE FAMILY MEMBER (5L265)
    1e-20  28%  1fjhA  [c.2.1.2] 3ALPHA-HYDROXYSTEROID DEHYDROGENASE/CARBONYL
    4e-20   5%  1u9jA  [c.2.1.2] HYPOTHETICAL PROTEIN YFBG
    1e-19  11%  1nytA1 [c.2.1.7] SHIKIMATE 5-DEHYDROGENASE A:102 -- 271
    1e-19  15%  1snyA  [c.2.1.2] SNIFFER CG10964-PA
    2e-19  16%  1bvrA  [c.2.1.2] PROTEIN (ENOYL-ACYL CARRIER PROTEIN (ACP)
    4e-19  11%  1h2iA  [d.50.1.3] DNA REPAIR PROTEIN RAD52 HOMOLOG
    5e-19  32%  1yxmA1 [c.2.1.2] PEROXISOMAL TRANS 2-ENOYL COA REDUCTASE A:7 -- 303
    5e-19   5%  1u7uA  [c.72.3.1] COENZYME A BIOSYNTHESIS BIFUNCTIONAL PROTEIN
    2e-18  23%  2bgkA1 [c.2.1.2] RHIZOME SECOISOLARICIRESINOL DEHYDROGENASE A:11 --
    1e-17  11%  1lu9A1 [c.2.1.7] METHYLENE TETRAHYDROMETHANOPTERIN DEHYDROGENASE
    3e-17  20%  1xseA  [c.2.1.2] 11BETA-HYDROXYSTEROID DEHYDROGENASE TYPE 1
    5e-16  17%  1d0iA  [c.23.13.1] TYPE II 3-DEHYDROQUINATE HYDRATASE
    5e-16  10%  1vhcA  [c.1.10.1] PUTATIVE KHG/KDPG ALDOLASE
    1e-15  23%  1yo6A1 [c.2.1.2] PUTATIVE CARBONYL REDUCTASE SNIFFER A:1 -- 250
    1e-15  11%  1qp8A1 [c.2.1.4] FORMATE DEHYDROGENASE A:83 -- 263
    1e-15  25%  1a4uA  [c.2.1.2] ALCOHOL DEHYDROGENASE
    7e-15  13%  2fr0A1 [c.2.1.2] ERYTHROMYCIN SYNTHASE, ERYAI A:1657 -- 1915
    9e-15  26%  2bd0A1 [c.2.1.2] SEPIAPTERIN REDUCTASE A:2 -- 241
    4e-14  10%  1gu7A2 [c.2.1.1] 2,4-DIENOYL-COA REDUCTASE A:161 -- 349
    6e-14  11%  1vlwA  [c.1.10.1] 2-DEHYDRO-3-DEOXYPHOSPHOGLUCONATE ALDOLASE/4-
    1e-13   6%  2joeA1 [d.371.1.1] HYPOTHETICAL LIPOPROTEIN YEHR A:2 -- 131
    4e-13  15%  1a4iA1 [c.2.1.7] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:127 --
    6e-13  13%  1qorA2 [c.2.1.1] QUINONE OXIDOREDUCTASE A:113 -- 291
    1e-12  10%  1di6A  [c.57.1.1] MOLYBDENUM COFACTOR BIOSYTHETIC ENZYME
    3e-12  12%  1b8pA1 [c.2.1.5] PROTEIN (MALATE DEHYDROGENASE) A:3 -- 158
    9e-12  12%  1adeA  [c.37.1.10] ADENYLOSUCCINATE SYNTHETASE
    1e-11   9%  1i24A  [c.2.1.2] SULFOLIPID BIOSYNTHESIS PROTEIN SQD1
    2e-11   7%  1c3vA1 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:501 -- 605 A:715
    2e-10   7%  1a9yA  [c.2.1.2] UDP-GALACTOSE 4-EPIMERASE
    4e-10   8%  1rkxA  [c.2.1.2] CDP-GLUCOSE-4,6-DEHYDRATASE
    2e-09  12%  1hdoA  [c.2.1.2] BILIVERDIN IX BETA REDUCTASE
    3e-09  14%  1ftrA1 [d.58.33.1] FORMYLMETHANOFURAN\:TETRAHYDROMETHANOPTERIN A:1
    2e-08   9%  1e1cA2 [c.23.6.1] METHYLMALONYL-COA MUTASE ALPHA CHAIN A:561 -- 728
    9e-08   8%  1vm6A3 [c.2.1.3] DIHYDRODIPICOLINATE REDUCTASE A:1 -- 96 A:183 --
    1e-07  11%  1edzA1 [c.2.1.7] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE A:149
    1e-07  10%  2ib0A1 [a.25.1.9] CONSERVED HYPOTHETICAL ALANINE RICH PROTEIN A:17
    3e-07  13%  1bw3A  [b.52.1.2] BARWIN, BASIC BARLEY SEED PROTEIN
    1e-05  12%  2bkaA1 [c.2.1.2] TAT-INTERACTING PROTEIN TIP30 A:5 -- 236
    7e-05  17%  2auwA2 [d.331.1.1] HYPOTHETICAL PROTEIN NE0471 A:4 -- 87
    2e-04  14%  2a35A1 [c.2.1.2] HYPOTHETICAL PROTEIN PA4017 A:4 -- 215
    5e-04  10%  1cjcA1 [c.3.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:107 -- 331
    8e-04   8%  1npdA1 [c.2.1.7] HYPOTHETICAL SHIKIMATE 5-DEHYDROGENASE-LIKE A:107
:264

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MGNALQGRHALVTXXXXXXXXXXXXXXXXXXXSVTLLGREQAALDATVHALQSCVIEGAALGAVSADITD
1pwxA           -------------------------------------------------------LEAFAETYPQLKPMS
1a27A           ------RTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAAALACPPGSLETLQLDV
1bdbA           ----LKGEAVLITGGASGLGRALVDRFVAEGAKVAVLDKSAERLAELETDHGDNV--LGIVGDVRSLEDQ
1nasA           ----LGCAVCVLTGASRGFGRALAPQLARLLSPGSVMLVSARSESMLRQLKEEDLKVVLAAADLGTEAGV
1zemA1          ----FNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEASVREK---GVEARSYVCDVTS
1ahhA           --------------------------------SVVVSDINADAANHVVDEIQQ---LGGQAFACRCDITS
2gdzA1          ----VNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALHEQFEPQKTL-FIQCDVAD
1xg5A           ----WRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTVGNIEELAAECKSAGYPGTLIP-YRCDLSN
1dohA           ----LEGKVALVTGAGRGIGREMAMELGRRGCKVIVNYANSTESAEEVVAAIKKN--GSDAACVKANVGV
1h5qA           FTISFVNKTIIVTGGNRGIGLAFTRAVAAAGANVAVIYRSAADAVEVTEKVGKEFGVKTK--AYQCDVSN
1yb1A           ---SVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAK---CKGLGAKVHTFVVDCSN
1x74A1          ------------------------------------PGPHAAMILGDLGADVVRIDRPISRDAMLRNRRI
1w6uA           ----FQGKVAFITGGGTGLGKGMTTLLSSLGAQCVIASRKMDVLKATAEQISSQT--GNKVHAIQCDVRD
1c14A           ---------------------------------LAFTYQNDKLKGRVEEFAAQLG----SDIVLQCDVAE
1o5iA           ---GIRDKGVLVLAASRG------------------IGRAVADVLSQEGAEVTICARNEELLKRSGHRYV
2ag5A1          MGR-LDGKVIILTAAAQGIGQAAALAFAREGAKVIATDINESKLQELEKYPGIQ--------TRVLDVTK
2zqnA1          ----------------------------------------------------------------------
2c54A1          ----SENLKISITGAGGFIASHIARRLKHEGHYVIA----SDWKKNEHMTEDMFCDEFHLVDLRVMENCL
1n5dA           ---SSNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAE--GLSPRFHQLDIID
1e5lA2          ---------------------------------------------------------------------D
1zbqA1          ---------------------------------FKGVGKGSLAADKVVEEI------RRRGGKAVANYDS
1ae1A           ---SLKGTTALVTGGSKGIGYAIVEELAGLGARVYTCSRNEKELDECLEIWREKGLN--VEGSVCDLLSR
1dhrA           ----------------------------------------------------------------------
1jr2A           ----PEDYGGLIFTSPRAVEAAELCLEQNNKTEVWERSLKEKWNAKSVYVVGNATASLVSKIGLDTEGET
1spxA           ----FAEKVAIITGSSNGIGRATAVLFAREGAKVTITGRHAERLEETRQQILAAGVSEQNVNSVVADVTT
1fjhA           ---------------------------------------------------------------VIADLST
1u9jA           -----------------------------------------------------FLNHPHFHFVEGDISIH
1nytA1          ---------------------------------------------------------------------A
1snyA           ---------------------------------LFTTCRNREQAKELEDLAKN----HSNIHILEIDLRN
1bvrA           ----LDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAKAPLLELDVQNEEH
1h2iA           -----------------------------------QCQYTAEEYQAIQKALRQ---RLGPEYISSRMAGG
1yxmA1          ----------------------------------------------------------------------
1u7uA           ----LKHLNIMITAGPTREPLDPVRYISDHSSGKMGFAIAAAAARRGA-NVTLVSGPVSLPTPPFVKRVD
2bgkA1          ----LQDKVAIITGGAGGIGETTAKLFVRYGAKVVIADIADDHGQKVCNNIGS----PDVISFVHCDVTK
1lu9A1          ---------------------------------VVLCGRKLDKAQAAADSVN----KRFKVNVTAAETAD
1xseA           -------------------------------------------------------------------MED
1d0iA           ---------------------------------LNLLGQRQPYGSDTLADVEALCVKAAAAHGGTVDFRQ
1vhcA           ----ELKIVPVIALDNADDILPLADTLAKNGLSVAEITFRSEAAADAIRLLRAN---RPDFLIAAGTVLT
1yo6A1          ----------------------------------------------------------------------
1qp8A1          EIPLIQGEKVAVLGLGEIGTRVGKILAALGAQVRGFSRTPKEGPWRFTNSLEEALREARA---AVCALPL
1a4uA           ----------------------------------------------------------------------
2fr0A1          ---------------------------------HLLLVSRSGPDADGAGEVAELEALGARTTVAACDVTD
2bd0A1          ---------------------------------------------------------------ITADISD
1gu7A2          ---------------------------------------------------------------TEDQNNS
1vlwA           ----KHKIVAVLRANSVEEAKEKALAVFEGGVHLIEITFTVPDADTVIKELSFLKEKGAI--IGAGTVTS
2joeA1          -------------------------------------------------------SSETKIQFASIGATT
1a4iA1          TGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGDILVVATGQPEMVKGEWIK
1qorA2          ----------------------------------------------------------------------
1di6A           -------------------------------------------------------------------IPD
1b8pA1          ----------------------------------------------------------------------
1adeA           ---------------------------------VGDLFDKETFAEKLKEVMEYH--NFQLVNYYKAEAVD
1i24A           ------GSRVMVIGGDGYCGWATALHLSKKNYEVCIVDNLVRRLFDHQLGLESL---TPIASIHDRISRW
1c3vA1          ---------------------------------TLSAELDAGDPLSLLTDG-----------NTEVVIDF
1a9yA           ----------------------------------------------------------------------
1rkxA           ----------------------------------------------------------------------
1hdoA           --------------------------------------------------------AGYEVTVLVRDSSR
1ftrA1          ---------------------------------VLITAASHKWAMIAVKE---ATGFGTSVIMCPAEAGI
1e1cA2          ------------------------------------------------ETARQAVEADVHVVGVSSLAGG
1vm6A3          ----------------------------------------------------------------------
1edzA1          EGNRLYGKKCIVINRSEIVGRPLAALLANDGATVYSVDVNNIQKFTRGESLKLNKHHVE-------DLGE
2ib0A1          ------ATIYGYGIVSALSPPGVNFLVADALKQHRHRRDDVIVMLSARGVTAP---IAAAGYQLPMQVSS
1bw3A           ---ATYHYYRPAQNNWDLGAPAVSAYCATWDASKPLSWRSKYGWTAFCGPAGP---RGQAACGKCLRVTN
2bkaA1          ----------------------------------------------------------------------
2auwA2          ----------------------------------------------------------------------
2a35A1          ----------------------------------------------------------------------
1cjcA1          --------------------------------------------------------------IVGRRGPL
1npdA1          -GFDIKGKTXVLLGAGGASTAIGAQGAIEGLKEIKLFNRRDEFFDKALAFAQRVNENTDCV-VTVTDLAD


                         .         .         *         .         .         .         .:140
query           ADWVSGAFAGATEARGPITLLVNNAGQAYSAPFGKTDLALWQRMLEVNLTGTFICTQAALPAMLEAGWGR
1pwxA           EQEPAELIEAVTSAYGQVDVLVSNDIFAPEQPIDKYAVEDYRGAVEALQIRPFALVNAVASQMKKRKSGH
1a27A           RDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTVRMLQAFLPDMKRRGSGR
1bdbA           KQAASRCVARFGKIDTLIPAGIWDYSTALVDLPEESLDAAFDEVFHINVKGYIHAVKACLPALVASR-GN
1nasA           QRLLSAVRELPRPEGLQRLLLINNAATLGDVSKGFNDLAEVNNYWALNLTSMLCLTSGTLNAFQDSPGKT
1zemA1          EEAVIGTVDSVVRDFGKIDFLFNNAGQGAFAPVQDYPSDDFARVLTINVTGAFHVLKAVSRQMITQNYGR
1ahhA           EQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPM-ADFRRAYELNVFSFFHLSQLVAPEMEKNGGGV
2gdzA1          QQQLRDTFRKVVDHFGRLDILVNNAGVNNEKN--------WEKTLQINLVSVISGTYLGLDYMSKQNGGI
1xg5A           EEDILSMFSAIRSQHSGVDICINNAGLARPDTLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNVGH
1dohA           VEDIVRMFEEAVKIFGKLDIVCSNSGVVSFGHVKDVTPEEFDRVFTINTRGQFFVAREAYKHLEIGGRLI
1h5qA           TDIVTKTIQQIDADLGPISGLIANAGVSVVKPATELTHEDFAFVYDVNVFGVFNTCRAVAKLWLQKQQKG
1yb1A           REDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGH
1x74A1          VTADLKSDQGLELALKLIAKADVLIEGYRPGVTERLGLGPEECAKVNDRLIYARMTGWGQTGPRSQQAGH
1w6uA           PDMVQNTVSELIKVAGHPNIVINNAAGNFISPTERLSPNAWKTITDIVLNGTAFVTLEIGKLIKAQKGAA
1c14A           DASIDTMFAELGKVWPKFDGFVHSIGFADGDYVNAVTREGFKIAHDISSYSFVAMAKACRSML--NPGSA
1o5iA           VCDLRKDLDLLFEKVKEVDILVLNAGGPKAGFFDELTNEDFKEAIDSLFLNMIKIVRNYLPAMKEKGWGR
2ag5A1          KKQI----DQFANEVERLDVLFNVAGFVHHGTVLDCEEKDWDFSMNLNVRSMYLMIKAFLPKMLAQKSGN
2zqnA1          ----------------------------------------------FFYIKSELNGKVLDIEGQNPAPGS
2c54A1          KVTEGVDHVFNLAADMGGMGFIQSNHSVIMYNNTMISFNMIEAARINGIKRFFYASSACIYPEFKQ-LET
1n5dA           LQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLI--KPQGR
1e5lA2          HLYAIKTIEEVHAAGGKIKTFLSYCG---GLPAPESSDNPLGYKFSWSSRGVLLALRNAASFYKD---GK
1zbqA1          VEEGEKVVKTALDAFGRIDVVVNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGR
1ae1A           TERDKLMQTVAHVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAYPLLKASQNGN
1dhrA           ------------GDQKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEG--GL
1jr2A           CGNAEKLAEYCSRESSALPLLFPCGNLKREILPKALKDKGIAMESIPGIQGNLNSYYSQQGVPASITFFS
1spxA           DAGQDEILSTTLGKFGKLDILVNNAGQSIES---------YDATLNLNLRSVIALTKKAVPHLSSTKGEI
1fjhA           AEGRKQAIADVLAKCSGMDGLVLCAGLGPQT-------KVLGNVVSVNYFGATELMDAFLPALKKGHQPA
1u9jA           SEWIEYHVKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLRIIRYCVKYRKRIIFPSTSEGMCSDKYF
1nytA1          HTGSIQALSMDELEGHEFDLIINATSSGISGDIPAIPSSLIHPGIYCYDMFYQKGKTPFLAWCEQRGSKR
1snyA           FDAYDKLVADITKDQGLNVLFNNAGIAPKSARITAVRSQELLDTLQTNTVVPIXAAKANESQPXGVGRAA
1bvrA           LASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPYADVSKGIHISAYSYASMAKALLPIMNPGGSIV
1h2iA           GQKVCYIEGHRVINLANEMFGYNGWAH-SITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGV
1yxmA1          -----------------------NGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGS
1u7uA           VMTALEMEAAVNASVQQQNIFIGCAAVADYRAALTIKMVKNPDIVAGVAALKDHRPY--VVGFAAETNNV
2bgkA1          DEDVRNLVDTTIAKHGKLDIMFGNVGVLSTTSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKKGS
1lu9A1          DASRA-----EAVKGAHFVFTAGAIGLELLPQAAWQNESSIEIVADYNAQPPLGIGGIDATDKGKEYGGK
1xseA           MTFAEEFVAEAGNLMGGLDMLILNHVLYNRLTFFHGEIDNVRKSMEVNFHSFVVLSVAAMPMLMQSQGSI
1d0iA           SNHEGELVDWIHEARLNHGIVINPAAYSHTSVAILDALNTGLPVVEVHISNIH---------QREPFRHH
1vhcA           AEQVVLAKSSGADFVVTPGLNPKIVKLCQDLNFPITPGVNNPXAIEIALEXGISAV-----------KFF
1yo6A1          ----------------------NAGVLLSYGTNTEPNRAVIAEQLDVNTTSVVLLTQKLLPDQLSVSRAA
1qp8A1          NKHTRGLVKYQHLALXAEDAVFVNVGRAEVLDRDGVLRILKERPQFIFASDVWWGRNDFAKDAEFFSLPN
1a4uA           --------------------------------AGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGP
2fr0A1          RESVRELLGGI-GDDVPLSAVFHAAATLDDGTVDTLTGERIERASRAKVLGARNLHELTRELDLTA----
2bd0A1          MADVRRLTTHIVERYGHIDCLVNNAGVGRFGALSDLTEEDFDYTMNTNLKGTFFLTQALFALMERQHSGH
1gu7A2          REFGPTIKEWIKQSGGEAKLALNCVGGKSSTGIARKLNN-NGLMLTYGGMSFQPVTIPTSLYIFKNFTSA
1vlwA           VEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKAMKLGLFPGEVVGPQFVKAMKGP
2joeA1          KEDAAKTLEPLSAKYKNIAGVEEKLTYTDTYAQENMEKVDFKALQGISGINVSAEDAKKGITMAQMGFKE
1a4iA1          PGAIVIDCGINYKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESA-----------------
1qorA2          ---------------------------------------CLQRRGLMVSFGNSSGAVTGVNLGILNQKGS
1di6A           EQAIIEQTLCELVDEMSCHLVLTTGGTGP--ARRDVTPDATLAVADREMPGFGEQMRQISLHF---VPTA
1b8pA1          ---------------------KDADVALLVGARPRGPGMERKDLLEANAQIFTVQGKAIDAVASR--NIK
1adeA           YQKVLDAVADILTSMVVDVSDLLDQARQR-----------GDFVMFEGAQGTLLDIDHGTYPYVTSSNTT
1i24A           KALTGKSIELYVGDICDFEFLAESFKSFEPDSVVHFGEQRSRSRAVYTQHNNVIGTLNVLFAIKEFGEEC
1c3vA1          THPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVLIAPNFTSFVPGVLLAVRRIAER
1a9yA           ----------------------------------------VNGTLRLISAMRAANVKNFIFSSAATVYGD
1rkxA           ---------------------------------------VMGTVYLLEAIRHVGGVKAVVNITSDKCYDN
1hdoA           LPSEGPRPAHVVVGDVLQAADVDKTVAGQDAVIVLLGTRNDLSPTTVMSE----GARNIVAAMKAHGVDK
1ftrA1          DCGYVPPEETPDGRPGVTIMIGHNDEDELKEQ-------LLDRIGQCVMTAPTASAFDAMPEAEK---ED
1e1cA2          HLTLVPALRKELDKLGRPDILITVGGVIPEQDFDELRKDGAVEIYTPGTVIPESA-ISLVKKLRASL---
1vm6A3          --------TVDLCKKYRAGLVLGTTALKEEHLQMLRELSVQAYSRTVFAIGALKAAEFLVGKDPGMYSFE
1edzA1          YSEDLLKKCSLDSDVVITGVPSENYKFPTEYIKE------GAVCINFACTKNFSDDVKEKASLYVPMTG-
2ib0A1          AADAARLAVRMEDGATAWRAVVEHAETADDRVFASTALSAVMATRWNRVLGAWPITAA------------
1bw3A           PATGAQITARIVDQCGGLDLDWDTVFT----KIDTNGIGYQQGHLNVNYQFVD-----------------
2bkaA1          ----------------------------------------------------RDYVLKSAELAKAGGCKH
2auwA2          ----------------------------------------------------------------------
2a35A1          ----------------------------------------EAGSEEAFRAVDFDLPLAVGKRALEMGARH
1cjcA1          QVAFTIKELREMIQLPGTRPMLDPADFLGLQDRIKEAARPRKRLMELLLRTAT-----------------
1npdA1          QQAFAEAL-------ASADILTNGTKVGXKPLENESLVNDISLLHPGLLVTECVYNPHKLLQQAQQAGCK


                         +         .         .         .         .         *         .:210
query           IVNVASTAGLIGYGYVSAYCAAKHGVIGLTRSLALELATKGVTVNAVCPGYTETDIVRDAVANIVGKTGR
1pwxA           IIFITSATPFGPWKELSTYTSARAGACTLANALSKELGEYNIPVFAIGPNYLHSEDSPYFYP---TEPWK
1a27A           VLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDR
1bdbA           VIFTISNAGFYPNGGGPLYTAAKHAIVGLVRELAFELA-PYVRVNGVGSGGINSDLRGP----------S
1nasA           VVNISSLCALQPYKGWGLYCAGKAARDMLYQVLAAEE--PSVRVLSYAPGPLDNDMQQL------ARETS
1zemA1          IVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRVNAISPGYMGPGFMWERQVELQAKVGS
1ahhA           ILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITP-------
2gdzA1          IINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALNLMNSGVRLNAICPGFVNTAILESIEKE---ENMG
1xg5A           IININSMSGHLPLSVTHFYSATKYAVTALTEGLRQELAQTHIRATCISPGVVETQFAFKL----------
1dohA           LMGSITGQA-KAVPKHAVYSGSKGAIETFARCMAIDMADKKITVNVVAPGGIKTDMYHAVCREYIPNGEN
1h5qA           SIVVTSSSSLNGSLTQVFYNSSKAACSNLVKGLAAEWASAGIRVNALSPGYVNTDQTAHMDKKIRDHQAS
1yb1A           IVTVASAAH-VSVPFLLAYCSSKFAAVGFHKTLTDELAITGVKTTCLCPNFVNTGFIKNP-STSLGPTLE
1x74A1          DINYISLNGILHAIGRGDERPVPPLNLVGDFGGGSMFLLVGILAALWERQSSGKGQVVDAAMVDGSSVLI
1w6uA           FLSITTIYAETGSGFVVPSASAKAGVEAMSKSLAAEWGKYGMRFNVIQPGPIKTLDPT------------
1c14A           LLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLA---------ASGIK
1o5iA           IVAITSFSVISPIENLYTSNSARMALTGFLKTLSFEVAPYGITVNCVAPGWTETERVKE----------L
2ag5A1          INMSSVASSVKGVVNRCVYSTTKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQE-----RIQARG
2zqnA1          KIITWDQKKGPTAVNQLWYTDQQGVIRSKLNDFAIDASHEQIETQPFDPNNPKRAW-----------IVS
2c54A1          TNVSLKESDAWPAEPQDAYGLERLATEELCKHYNKDFGIECRIGRFHNIYGPFGTWKG------------
1n5dA           VVNVSSTEGVRALNECSPELQQKFKSETITEEELVGLAGDKILLNACCPGWVRTDMGGPKAP--------
1e5lA2          VTNVAGPELMATAKPYFIYPGFAFV--AYPNRDSTPYKERIVRGTLRYQGFPQFIKVKEATQKIVKASSA
1zbqA1          IIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQT------------
1ae1A           VIFLSSIAGFSALPSVSLYSASKGAINQMTKSLACEWAKDNIRVNSVAPGVIL-----------------
1dhrA           LTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKGMPSGAAAIAVLPVTLDTPMNRKSMPEA------
1jr2A           PSGLTYSLKHIQELSGDNIDQIKFAAIG--PTTARALAAQGLPVSCTAESPTPQALATGIRKAL------
1spxA           VNISSIASGLHATPDFPYYSIAKAAIDQYTRNTAIDLIQHGIRVNSISPGLVATGFYST-----------
1fjhA           AVVISSVASAHLAGGNLAYAGSKNALTVAVRKRAAAWGEAGVRLNTIAPGAFVP----------------
1u9jA           DEDHSNLIVGPVNKPRWIYSVSKQLLDRVIWAYGEKEGLQFTLFRPFNWMGPRLDNLNSSRAITQLILNL
1nytA1          NADGLGMLVAQAAHAFLLWHGVLPDVEPVIKQLQEELS--------------------------------
1snyA           IISILGSIQGNTDGGXYAYRTSKSALNAATKSLSVDLYPQRIXCVSLHPGWVKTD---------------
1bvrA           GMDFDPSRAMPAYNW---MTVAKSALESVNRFVAREAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEAG
1h2iA           SEGLKSKALSLEKARKEAVTDGLKALRSFGNALGNCILDK-DYLRSLNKLPRQLPLEVDLT---------
1yxmA1          I-VNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVEN-------YGS
1u7uA           EEYARQKRIRKNLDLICANSDNNALHLFWQDGDKV-----------------------------------
2bgkA1          IVTASISSFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDV------FGVD
1lu9A1          RAFGALGIGKLHRACIAKLFESSEGVFDAEEIYKLA----------------------------------
1xseA           A-VVSSVAGKITYPLIAPYSASKFALDGFFSTLRSEFLVNKVSITLCILGLIDTETAIKATSGIYLGPAS
1d0iA           SYVSQRADGVVAGCGVQGYVFGVERIAAL-----------------------------------------
1vhcA           PAEASGGVKXIKALLGPYAQLQIXPTGGIGLHNIRDYLAIPNIVACGGSWFVEKKLIQSNNWDEIGRLVR
1yo6A1          VITISSGLGSITDNTSGSAQMSKAAINMFGRTLAVDLKDDNVLVVNFCPGWVEQSTAELI---------S
1qp8A1          VVATPWVAG-------------------------------------------------------------
1a4uA           IANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVH---------TFN
2fr0A1          FVLFSSFASAFGAPGLGGYAPGNAYLDGLAQQRRSDGLPATAVAWGTWAGSGMAEG--------------
2bd0A1          IFFITSVAATKAFRHSSIYCMSKFGQRGLVETMRLYARKCNVRITDVQPGAVYTPMWGK-----------
1gu7A2          GFWVTELLKN----NKELKTSTLNQIIAWYEE--------------------------------------
1vlwA           FPNVKFVPTGGNLDNVCEWFKAGVLAVGVGSAL-VKGTPDEVREKAKAFVEKIRG---------------
2joeA1          V---------------------------------------------------------------------
1a4iA1          ----------------------------------------------------------------------
1qorA2          YVTRPSLQGYITTREELTEASNELFS-LIASGV-------------------------------------
1di6A           ILSRQVGVIRKQALILNLPGQPKSIKETLEGVKDAEGNVVVHGIFASVPYCIQLLEGPY-----VETAPE
1b8pA1          VLVVGNPANTNAYAMKSAPSLPAKNFTAM-----------------------------------------
1adeA           AGGVATGSGLGPRYVDYVLGILKAYSTRVGAELFDETGEF------------------------------
1i24A           HLVKLGTMGEYGTPNIDIEEGYITITHNGRTDTLPYPKQASSFYHLSK----------------------
1c3vA1          PGLTVGLEPLL-----------------------------------------------------------
1a9yA           QPKIPYVESFPTGTPQSPFGKSKLMVEQILTDLQKAQPDWSIALLRYFNPVGAHP---------------
1rkxA           KEWIWGYRENEAMGGYDPYSNSKGCAELVTSSYRNSFFNPANYGQHGTAVAT------------------
1hdoA           VVACTSAFLLWDPTKVPPRLQAVTDDHIRMHK---VLRESGLKYVAVMPPHIGDQPLTGAYTVT------
1ftrA1          EDRVGYKLSFFGDGY-------------------------------------------------------
1e1cA2          ----------------------------------------------------------------------
1vm6A3          EVI-------------------------------------------------------------------
1edzA1          KVTIA-----------------------------------------------------------------
2ib0A1          ----------------------------------------------------------------------
1bw3A           ----------------------------------------------------------------------
2bkaA1          FNLLSSKG--ADKSSNFLYLQVKGEVEAKVEEL------KFDRYSVFRPGVLLCDRQESRPGE------W
2auwA2          ----------------------------------------------------------------------
2a35A1          YLVVSALGA--DAKSSIFYNRVKGELEQALQEQG------WPQLTIARPSLLFGPREEFRLAEIL-----
1cjcA1          ----------------------------------------------------------------------
1npdA1          TIDGYGXLLWQGAEQFTLWTGKDFPLEYVKQVXG------------------------------------


                         .         .         .         +         .         .         .:280
query           SEEQARAELAARNPQRRLVRPDEVADAVAWLCQPSASAITGQAVPVAGGEVMAG
1pwxA           TNPEHVAHVKKVTALQRLGTQKELGELVAFLASGSCDYLTGQVFWLAGGFPM--
1a27A           TDIHTFHRFSKQVFREAAQNPEEVAEVFLTAPKPTLRYFTTE------------
1bdbA           SLGPLADMLKSVLPIGRMPEVEEYTGAYVFFARGDAAPATGALLNYDGGLGVRG
1nasA           KDPELRSKLQKLKSDGALVDCGTSAQKLLGLLQK-DTFQSGAHVDFY-------
1zemA1          QPKVVAQQMIGSVPMRRYGDINEIPGVVAFLLGDDSSFMTGVNLPIAGG-----
1ahhA           ---EIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGV---
2gdzA1          QYIEYKDHIKDMIKYYGILDPPLIANGLITLI--EDDALNGAIMKITTSK----
1xg5A           ----HDKDPEKAAATYECLKPEDVAEAVIYVLSTPAHIQIGDIQMRPTG-----
1dohA           LEEVDEYAAVQWSPLRRVGLPIDIARVVCFLASNDGGWVTGKVIGIDGGACM--
1h5qA           -----------NIPLNRFAQPEEMTGQAILLLSDHATYMTGGEYFIDGGQLI--
1yb1A           PEEVVNRLMHGLTEQKMIFIPSSIA-----------------------------
1x74A1          QMMWAMRATGMWTDTRGANMLDGGAPYYDTYECADGRYVAVGAIE---------
1w6uA           --GTFEKEMIGRIPCGRLGTVEELANLAAFLCSDYASWINGAVIKFDGGEEVLI
1c14A           DFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAA
1o5iA           LSEEKKKQVESQIPMRRMAKPEEIASVVAFLCSEKASYLTGQTIVVDGGLSKFP
2ag5A1          NPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL--
2zqnA1          GNTIAQLSDRDIVLDIIKSDKEAGAHICAWKQHGGPNQK---------------
2c54A1          ------------------------------------------------------
1n5dA           ----KSPEVGAETPVYLALLPSDAEGPHGQFVTDKKVVEWGVPPESYPW-----
1e5lA2          SEQDIVSTIVSNATFESTEEQKRIVAGLKWLGIFSDKKITPRGNALD-------
1zbqA1          ---------VMPEDLVEALKPEYVAPLVLWLCHE-SCEENGGLFEVGAGWIG--
1ae1A           -QKEEIDNFIVKTPMGRAGKPQEVSALIAFLCFPAASYITGQIIWADGGFTANG
1dhrA           -------------DFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTT-----
1jr2A           ------------------------------------------------------
1spxA           -----MATMKECVPAGVMGQPQDIAEVIAFLARKTSSYIIGHQLVVDGG-----
1fjhA           -------------PMGRRAEPSEMASVIAFLMSPAASYVHGAQIVIDGG-----
1u9jA           VEGSPIKLIDGGKQKRCFTDIRDGIEALYRIIENAGNRCDGEIINIGNP-----
1nytA1          ------------------------------------------------------
1snyA           -----------XGGSSAPLDVPTSTGQIVQTISKLGEKQNGGFVNYDGTPL---
1bvrA           AQLLEEGWDQRAPIGWNMKDATPVAKTVCALLSDWLPATTGDIIYADGGAHTQL
1h2iA           --KAKRQDLEPSVEEARYNSC---------------------------------
1yxmA1          WGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYT
1u7uA           ------------------------------------------------------
2bgkA1          SSRVEELAHQAANLKGTLLRAEDVADAVAYLAGDESKYVSGLNLVIDGGYTRTN
1lu9A1          ------------------------------------------------------
1xseA           PKEECALEIIKGTALRQ--------DEMYYVGSRWVPYLLGNPGR---------
1d0iA           ------------------------------------------------------
1vhcA           EVIDIIKE----------------------------------------------
1yo6A1          SFNKLDNSHNGR-FFMRNLKPYE-------------------------------
1qp8A1          ------------------------------------------------------
1a4uA           SWLDVEPRVAELLLSHPTQTSEQCGQN---FVKAIEANKNGAIWKLDLGTLEA-
2fr0A1          -----PVADRFRRHGVIEMPPETACRALQNALDRAEVCPIVIDVRWDRFLLAY-
2bd0A1          ---------VDDEMQALMMMPEDIAAPVVQAYLQPSRTVVEEIIPTSGD-----
1gu7A2          ------------------------------------------------------
1vlwA           ------------------------------------------------------
2joeA1          ------------------------------------------------------
1a4iA1          ------------------------------------------------------
1qorA2          ------------------------------------------------------
1di6A           VVAAFRPKSARR------------------------------------------
1b8pA1          ------------------------------------------------------
1adeA           ------------------------------------------------------
1i24A           ------------------------------------------------------
1c3vA1          ------------------------------------------------------
1a9yA           ------------------------------------------------------
1rkxA           ------------------------------------------------------
1hdoA           ---------LDGRGPSRVISKHDLGHFMLRCL--TTDEYDGHSTYPSHQ-----
1ftrA1          ------------------------------------------------------
1e1cA2          ------------------------------------------------------
1vm6A3          ------------------------------------------------------
1edzA1          ------------------------------------------------------
2ib0A1          ------------------------------------------------------
1bw3A           ------------------------------------------------------
2bkaA1          LVRKFFGSLPDSWASGHSVPVVTVVRAMLNNV--VRPRDKQMELLENKAIHDLG
2auwA2          -------------FFPKLTAVEALAPYRL-----RTTWSTGEVLEVDVGDILRK
2a35A1          ------------------------------------------------------
1cjcA1          ------------------------------------------------------
1npdA1          ------------------------------------------------------