[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF09298.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1darA2.bssp"
#ERROR : Can't open dsspfile "1n0uA2.bssp"
#ERROR : Can't open dsspfile "1h2tC3.bssp"
#ERROR : Can't open dsspfile "1n0uA5.bssp"
#ERROR : Can't open dsspfile "1wdtA2.bssp"
#ERROR : Can't open dsspfile "1f60A3.bssp"
#ERROR : Can't open dsspfile "1darA4.bssp"
#ERROR : Can't open dsspfile "1eniA.bssp"
#ERROR : Can't open dsspfile "1vfgA2.bssp"
#ERROR : Can't open dsspfile "1nriA.bssp"
#ERROR : Can't open dsspfile "1puiA.bssp"
#ERROR : Can't open dsspfile "1aipA3.bssp"
#ERROR : Can't open dsspfile "1o94C.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "1q4rA.bssp"
#ERROR : Can't open dsspfile "1vi7A2.bssp"
#ERROR : Can't open dsspfile "1p9qC3.bssp"
#ERROR : Can't open dsspfile "2hgjF1.bssp"
#ERROR : Can't open dsspfile "1o9nA.bssp"
#ERROR : Can't open dsspfile "1h65A.bssp"
#ERROR : Can't open dsspfile "1n0uA1.bssp"
#ERROR : Can't open dsspfile "2cxxA1.bssp"
#ERROR : Can't open dsspfile "1nrjB.bssp"
#ERROR : Can't open dsspfile "1egaA1.bssp"
#ERROR : Can't open dsspfile "1zd9A1.bssp"
#ERROR : Can't open dsspfile "1wb1A4.bssp"
#ERROR : Can't open dsspfile "1sulA.bssp"
#ERROR : Can't open dsspfile "2fh5B1.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "1g7rA4.bssp"
#ERROR : Can't open dsspfile "2bmjA1.bssp"
#ERROR : Can't open dsspfile "1wdtA1.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1upsA2.bssp"
#ERROR : Can't open dsspfile "1fnmA4.bssp"
#ERROR : Can't open dsspfile "1c82A1.bssp"
#ERROR : Can't open dsspfile "1aipA1.bssp"
#ERROR : Can't open dsspfile "2b3mA1.bssp"
#ERROR : Can't open dsspfile "1mkyA2.bssp"
#ERROR : Can't open dsspfile "1g7rA2.bssp"
#ERROR : Can't open dsspfile "1xe1A.bssp"
#ERROR : Can't open dsspfile "1zunB1.bssp"
#ERROR : Can't open dsspfile "1e0sA.bssp"
#ERROR : Can't open dsspfile "1r5bA1.bssp"
#ERROR : Can't open dsspfile "1darA1.bssp"
#ERROR : Can't open dsspfile "1n0uA4.bssp"
#ERROR : Can't open dsspfile "1g7rA1.bssp"
#ERROR : Can't open dsspfile "1xzpA2.bssp"
#ERROR : Can't open dsspfile "2q22A1.bssp"
#ERROR : Can't open dsspfile "1wb1A1.bssp"
#ERROR : Can't open dsspfile "1kjzA1.bssp"
#ERROR : Can't open dsspfile "1d1nA.bssp"
#ERROR : Can't open dsspfile "121pA.bssp"
#ERROR : Can't open dsspfile "1g7dA.bssp"
#ERROR : Can't open dsspfile "1f6bA.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "2p67A1.bssp"
#ERROR : Can't open dsspfile "1e6vB1.bssp"
#ERROR : Can't open dsspfile "1p5uB.bssp"
#ERROR : Can't open dsspfile "2c31A3.bssp"
#ERROR : Can't open dsspfile "1a2kC.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1agrA2.bssp"

## Summary of PDB Search
:597
    2e-37  36%  1darA2 [c.37.1.8] ELONGATION FACTOR G A:1 -- 282
    4e-34  39%  1n0uA2 [c.37.1.8] ELONGATION FACTOR 2 A:3 -- 343
    2e-30  10%  1h2tC3 [a.118.1.14] 80 KDA NUCLEAR CAP BINDING PROTEIN C:481 -- 790
    8e-30  19%  1n0uA5 [d.58.11.1] ELONGATION FACTOR 2 A:726 -- 842
    1e-29  25%  1wdtA2 [c.37.1.8] ELONGATION FACTOR G HOMOLOG A:8 -- 274
    2e-28  28%  1f60A3 [c.37.1.8] ELONGATION FACTOR EEF1A A:2 -- 240
    4e-25  28%  1darA4 [d.58.11.1] ELONGATION FACTOR G A:600 -- 689
    2e-21  12%  1eniA  [a.18.1.1] ENDONUCLEASE V
    2e-20  10%  1vfgA2 [d.218.1.4] POLY A POLYMERASE A:1 -- 136
    2e-20  11%  1nriA  [c.80.1.3] HYPOTHETICAL PROTEIN HI0754
    3e-20  13%  1puiA  [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB
    6e-20  23%  1aipA3 [c.37.1.8] ELONGATION FACTOR TU A:9 -- 212
    1e-19   9%  1o94C  [c.26.2.3] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    5e-19  14%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 -- 342
    5e-19  17%  1q4rA  [d.58.4.4] PROTEIN AT3G17210
    8e-19  25%  1vi7A2 [d.58.11.2] HYPOTHETICAL PROTEIN YIGZ A:138 -- 208
    2e-18  16%  1p9qC3 [d.58.11.3] HYPOTHETICAL PROTEIN AF0491 C:162 -- 234
    2e-18  17%  2hgjF1 [c.22.1.1] 50S RIBOSOMAL PROTEIN L4 F:3 -- 208
    4e-18  12%  1o9nA  [c.117.1.1] MALONAMIDASE E2
    3e-17  13%  1h65A  [c.37.1.8] CHLOROPLAST OUTER ENVELOPE PROTEIN OEP34
    3e-17  11%  1n0uA1 [b.43.3.1] ELONGATION FACTOR 2 A:344 -- 481
    6e-17  13%  2cxxA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB A:2 -- 185
    1e-16  12%  1nrjB  [c.37.1.8] SIGNAL RECOGNITION PARTICLE RECEPTOR BETA
    1e-16  15%  1egaA1 [c.37.1.8] PROTEIN (GTP-BINDING PROTEIN ERA) A:4 -- 182
    3e-16  13%  1zd9A1 [c.37.1.8] ADP-RIBOSYLATION FACTOR-LIKE 10B A:18 -- 181
    6e-16  29%  1wb1A4 [c.37.1.8] TRANSLATION ELONGATION FACTOR SELB A:1 -- 179
    7e-16  10%  1sulA  [c.37.1.8] GTP-BINDING PROTEIN YSXC
    4e-15  15%  2fh5B1 [c.37.1.8] SIGNAL RECOGNITION PARTICLE RECEPTOR BETA B:63 --
    5e-15  13%  1eg7A  [c.37.1.10] FORMYLTETRAHYDROFOLATE SYNTHETASE
    7e-15  24%  1g7rA4 [c.37.1.8] TRANSLATION INITIATION FACTOR IF2/EIF5B A:1 --
    9e-15  14%  2bmjA1 [c.37.1.8] CENTAURIN GAMMA 1 A:66 -- 240
    4e-14  17%  1wdtA1 [b.43.3.1] ELONGATION FACTOR G HOMOLOG A:275 -- 377
    5e-14  15%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    6e-14  19%  1upsA2 [b.42.2.3] GLCNAC-ALPHA-1,4-GAL-RELEASING ENDO-BETA- A:290
    8e-14  24%  1fnmA4 [d.58.11.1] ELONGATION FACTOR G A:404 -- 482
    8e-14  12%  1c82A1 [a.102.3.2] HYALURONATE LYASE A:171 -- 540
    7e-13  14%  1aipA1 [b.43.3.1] ELONGATION FACTOR TU A:213 -- 312
    2e-12  11%  2b3mA1 [d.38.1.4] HYPOTHETICAL PROTEIN AF1124 A:6 -- 159
    2e-12  18%  1mkyA2 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:173 -- 358
    2e-12  16%  1g7rA2 [b.43.3.1] TRANSLATION INITIATION FACTOR IF2/EIF5B A:460 --
    3e-12  13%  1xe1A  [b.43.3.1] HYPOTHETICAL PROTEIN PF0907
    3e-12  12%  1zunB1 [b.43.3.1] SULFATE ADENYLATE TRANSFERASE, SUBUNIT B:238 --
    4e-12  14%  1e0sA  [c.37.1.8] ADP-RIBOSYLATION FACTOR 6
    7e-12  17%  1r5bA1 [b.43.3.1] EUKARYOTIC PEPTIDE CHAIN RELEASE FACTOR GTP-
    2e-11  20%  1darA1 [b.43.3.1] ELONGATION FACTOR G A:283 -- 400
    4e-11  22%  1n0uA4 [d.58.11.1] ELONGATION FACTOR 2 A:482 -- 560
    4e-11  11%  1g7rA1 [b.43.3.1] TRANSLATION INITIATION FACTOR IF2/EIF5B A:228 --
    1e-10  16%  1xzpA2 [c.37.1.8] PROBABLE TRNA MODIFICATION GTPASE TRME A:212 --
    1e-10   7%  2q22A1 [d.365.1.1] UNCHARACTERIZED PROTEIN A:8 -- 138
    2e-10  13%  1wb1A1 [b.43.3.1] TRANSLATION ELONGATION FACTOR SELB A:180 -- 271
    8e-10  16%  1kjzA1 [b.43.3.1] EIF2GAMMA A:201 -- 321
    9e-10  18%  1d1nA  [b.43.3.1] INITIATION FACTOR 2
    1e-09  29%  121pA  [c.37.1.8] H-RAS P21 PROTEIN
    2e-08   9%  1g7dA  [a.71.1.1] ENDOPLASMIC RETICULUM PROTEIN ERP29
    5e-08  11%  1f6bA  [c.37.1.8] SAR1
    6e-08  14%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    2e-07  23%  2p67A1 [c.37.1.10] LAO/AO TRANSPORT SYSTEM KINASE A:1 -- 327
    3e-06  14%  1e6vB1 [a.89.1.1] METHYL-COENZYME M REDUCTASE I BETA SUBUNIT B:190
    1e-04  13%  1p5uB  [b.2.3.2] F1 CAPSULE ANTIGEN
    2e-04   9%  2c31A3 [c.36.1.9] OXALYL-COA DECARBOXYLASE A:370 -- 552
    3e-04  19%  1a2kC  [c.37.1.8] RAN
    3e-04  23%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    5e-04  19%  1agrA2 [c.37.1.8] GUANINE NUCLEOTIDE-BINDING PROTEIN G(I) A:5 -- 60
:597

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDHIRNFSIIAHIDHGKSTLADRIIQRCGGLSDREMEAQVLDSMDIEKERGITIKAQTAALSYKARDGQV
1darA2          LKRLRNIGIAAHIDAGKTTTTERILYYTG-------------------------RAAVTTCFWKD-----
1n0uA2          --NVRNMSVIAHVDHGKSTLTDSLVQRAGGITIKSTAISLYSEMSDEDVKEIKQKT----------DGNS
1h2tC3          ----------------------------------------------------------------------
1n0uA5          ----------------------------------------------------------------------
1wdtA2          ---IRTVALVGHAGSGKTTLTEALLYKTGAKERREEGTTTTDYTPEAKLHRTTVRTGVAPLLFR-----G
1f60A3          ---HINVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFVLDKLKAERERGITIDI-----ALWKFETPK
1darA4          ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          -----RDILLGKEVWDVDFVVEGNAIELAKELARRVHPFPEFGTAHLKIGKLKLEFATARRETV------
1nriA           --------CLPQISLAVEQIVQAFQQGGRLIYIGAGTSGRLGVLDASECPPTFGVSTEXVKGIIAGGECA
1puiA           ---VMSAPDIRHLPSDTGIEVAFAGRSNAGKSSATLTNQQLINLFEV-----ADGKRL----------VD
1aipA3          ----VNVGTIGHVDHGKTTLTAALTY-------------------VTAAENPTAHVEY--------ETAK
1o94C           ----------------------------------------------------------------------
1lnzA2          ---LADVGLVGFPSVGKSTLLSVVSSAKPKIADYHFTTLVPNLGXVETDDGRSFVXADLPGLIEGAHQGV
1q4rA           ---GVSPEKIEELIKGYANLVNLIEPXK-------AFHWGKDVSIENLHQGYTHIFESTFESKE------
1vi7A2          ----------------------------------------------------------------------
1p9qC3          ----------------------------------------------------------------------
2hgjF1          NPHLLWEVVRWRGTASTKTRGEVA------YSGRKIWPQKHTGRARHGDIGAPIFVGGGVVF-----GPK
1o9nA           ---------------------------------------IPLALGTQTGGSVIRPAAYCGTAAIK-----
1h65A           -APATQTKLLELLGNLKQEDVNSLVXGKGGVGKSSTVNSIIRVVSISPFQSEGPRPVXVSRSRAG-----
1n0uA1          ----------------------------------------------------------------------
2cxxA1          --------FAGRSNVGKSTLIYRLTGKKVRRGKRPGVTRKIIEIEWKNHKIIDXPGFGFXXGLPVQERIK
1nrjB           ---QPSIIIAGPQNSGKTSLLTLLTTD-------------------SVRPTVVSQEPLSAADYDGSGVTL
1egaA1          -SYCGFIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQAI-----------YVDT
1zd9A1          -----ELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKIT-----------------KGNVTIKL
1wb1A4          ---NINLGIFGHIDHGKTTLSKVLTEIAG---------------------------------FSAFKLEN
1sulA           -GGLPEIALAGRSNVGKSSFINSLINRKNLAQTLNFYIINDELHFVDVPGYGFAKVSK------------
2fh5B1          ----RAVLFVGLCDSGKTLLFVRLLT---------------GQYRDTQTSITDSSAIY----KVNNNRGN
1eg7A           ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------VIEGICGDFLKKFSIRET
2bmjA1          ---IPELRLLGDARSGKSSLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLI---------------
1wdtA1          ----------------------------------------------------------------------
1mkyA1          --------IVGRPNVGKSTLFNKLVKDP------------------------VQDTVEWYGKTFKLVDTC
1upsA2          -----NNYLIRNRQTGKFLY--------------------IEENNDKVSYGITLKNEKNAKWSKEYNETG
1fnmA4          ----------------------------------------------------------------------
1c82A1          -----------------------------------------DTYTDRLDDWNGIIAGNQY--YDSKNDQM
1aipA1          ----------------------------------------------------------------------
2b3mA1          ----------------------------------------------------------------------
1mkyA2          ITDAIKVAIVGRPNVGKSTLFNAILNKERALVSPIPVDDEVFIDGR------------------------
1g7rA2          ----------------------------------------------------------------------
1xe1A           ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1e0sA           --------------VLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVNVETVTYKNVKFNV
1r5bA1          ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1n0uA4          ----------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1xzpA2          -----RMVIVGKPNVGKSTLLNRLLNED----------RAIVTDIPGTTRDVISEEIVIRGILFRIVDTA
2q22A1          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
121pA           ------------------------------------------------------------------DGET
1g7dA           ----------------------------------------------------------------------
1f6bA           YKKTGKLVFLGLDNAGKTTLLHMLKDDPTLHPTSEELTIAGMTFTTFDLGGRRVWKNY-------LPAIN
1ni3A1          -GNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIEAKVAVPDERFDWL-----CEAYKPKSRVP
2p67A1          ---------------GKSTFLEAFGML---LIREGLKVAVIASNDLARAEAAFIRPVPSGASQRARELML
1e6vB1          ------------------------------------------------------------------LQQT
1p5uB           ----------------------------------------------------------------------
2c31A3          --------SLGVVRDFMLANPDISLVNEGANA-----------------LDNT------RMIVDMLKPR-
1a2kC           -------------------------------------------------------------------RGP
1t9hA2          ----------------------------------------------------------------------
1agrA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YNLNLIDTPGHVDFSYEVSRSLSACEGALLVVDASQGVEAQTVANCYTAIELGVEVVPVLNKIDLPQADP
1darA2          HRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSETVWRQAEKYKVPRIAFANKMDKTGADL
1n0uA2          FLINLIDSPGHVDFSSEVTAALRVTDGALVVVDTIEGVCVQTETVLRQALGERIKPVVVINKVDRALLEL
1h2tC3          -----------------------------YGDESSNSLVALCLAVAFKSKATNDEIFSILKDVPNPSFNP
1n0uA5          ----------------------------------------------------------------------
1wdtA2          HRVFLLDAPGYGDFVGEIRGALEAADAALVAVSAEAGVQVGTERAWTVAERLGLPRMVVVTKLDKGGDYY
1f60A3          YQVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGVGEFEAGISKDGLAFTLGVQLIVAVNKMDSVKWDE
1darA4          ----------------------------------------------------------------------
1eniA           --INLTLVSELADQHLMAEYRELPRVFGAVRKHVANGKRVRDFKISPTFILGAGHVTFFYDKLEFLRKRQ
1vfgA2          EPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLK----------------------------
1nriA           IRHPVEGAEDNTKAVLNDLQSIHFSKNDVLVGIAASGRTPYVIAGLQYAKSLGALTISIASNPKSEXAEI
1puiA           LPGYGEMKRKWQRALGEYLEKRQSLQGLVVLMDIRHPLKDLDQQMIEWAVDSNIAVLVLLTKADKLASGA
1aipA3          RHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQVGVPIVVFMNKVDMDPELL
1o94C           -------DAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGI--SVASYLNWPHAAVVADLQYKPGDN
1lnzA2          GL---GHQFLRHIERTRVIVHVIDXSGLEGRDPYDDYLTINQELSEYNLRLTERPQIIVANKXDXPEAAE
1q4rA           AVAEYIAHPAHVEFATIFLGSLDKVLVIDYKPTS------------------------------------
1vi7A2          ----------------------------------------------------------------------
1p9qC3          ----------------------------------------------------------------------
2hgjF1          PRDYSYTLPKKVRKGLAMAVADRAREGKLLLVEAFAGVNGKTKEFLAWAKEAGLDSESVLLVTGNAARNL
1o9nA           PSFRMLPTVGVKCYSWALDTVGLFGEDLARGLLAMTGRSEFSGIVPAKAPRIGVVRQEFAGAVEPAAEQG
1h65A           FTLNIIDTPGLIEGGYINDLLDKTIDVLLYVDRLDAYRVDNLDKLVAKAITDWNKAIVALTHAQFSPPDG
1n0uA1          ----------------------------------------------------------------------
2cxxA1          DEIVHFIEDNAKNIDVAVLVVDGKAAPEIIKRWEKRGEIPIDVEFYQFLRELDIPTIVAVNKLDKIKNVQ
1nrjB           VDFPGHVKLRYKLSDYLKTRAKFVKGLIFMVDSTTAEFLVDILSITESSCENGIDILIACNKSELFTARP
1egaA1          PGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLREGKAPVILAVNKVDNVQEKA
1zd9A1          WDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALD
1wb1A4          YRITLVDAPGHADLIRAVVSAADIIDLALIVVDAKEGPKTQTGEHMLILDHFNIPIIVVITKSDNAGTEE
1sulA           -----SEREAWGRMIETYITTREELKAVVQIVDLRHAPSNDDVQMYEFLKYYGIPVIVIATKADKIPKGK
2fh5B1          SLTLIDLPGHESLRFQLLDRFKSSARAVVFVVDSAAFQREVKDVAESMALKNSPSLLIACNKQDIAMAKS
1eg7A           ----------ATVRALKMHGGVPKSDLATENLEALREGFANLEKHIENIGKFGVPAVVAINAFPTDTEAE
1g7rA4          LGLFFIDTPGA--FTTLRKRGGALADLAILIVDINEGFKPQTQEALNILRXYRTPFVVAANKIDRIHGWR
2bmjA1          -----REEAGAPDAKFSGWADAVIFVFSLEDENSFQAVSRLHGQLSSLRGRGGLALALVGTQDRISASSP
1wdtA1          ----------------------------------------------------------------------
1mkyA1          GVFDNPQDIISQKXKEVTLNXIREADLVLFVVDGKRGITKEDESLADFLRKSTVDTILVANKAENLREFE
1upsA2          EYLNIENQTGYIEH-GKVPKTWWSAQWSEVPVDGYTRFVNRWKPNMSIHTESYEGV----LQYGVPNTYW
1fnmA4          ----------------------------------------------------------------------
1c82A1          AKLNQELEGKVADSLSSISSQAD-------RIYLWEKFSNYKTSANLTATYRKLEAKQVTNPSSRYYQDE
1aipA1          ----------------------------------------------------------------------
2b3mA1          ----------------------------------------------------------------------
1mkyA2          KYVFVDTAGLEKYSNYRVVDSIEKADVVVIVLDATQGITRQDQRXAGLXERRGRASVVVFNKWDLVVHRE
1g7rA2          ----------------------------------------------------------------------
1xe1A           ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1e0sA           WDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMK
1r5bA1          ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1n0uA4          ----------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1xzpA2          GVRSETNDLVERLGIERTLQEIEKADIVLFVLDASSPLDEEDRKILERIKNKRYLV--VINKVDVVEKIN
2q22A1          -------------------------------------------TADAKKILNKFNCL--DIAPILKPSEK
1wb1A1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
121pA           CLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRDVPMVLVGNKCDLAATVE
1g7dA           ----------------------------------------------------------------------
1f6bA           GIVFLVDCADHERLLESKE-----ELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQTTG
1ni3A1          AFLTVFDIAGLTKGASTGNAFLSHVRAVDAIYQVVRAFDDAEIIHVEGDVDPIRDLSIIVDELLI--KDA
2p67A1          YDVVIVETVGVGQSETEVARMVDC----FISLQIAQGIKKGL-------MEVADLIV--INKDDGDNHTN
1e6vB1          AMFEMGDALGPFERLHLLGYAYQGLNADNMVYDIVREVVERALEDGVIEVKEELPSFKVYKANDMDLWNA
1p5uB           ----------------------------------------------------------------------
2c31A3          -KRLDSGTWGVMGIGMGYCVAAAAVTGKPVIAVEGDSAFGFSGMELETICRYNLPVTVIIMNNGGIYKGN
1a2kC           IKFNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVENIPIVLCGNKVDIKDRKV
1t9hA2          ----------------ELIRPICNVDQAVLVFSAVQPSFSTALLDRF-----------------------
1agrA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ANAIQEIEDVIGIDAQDATPCSAKTGQGVEDVIEALIAKVPPPKGDAAAPLQALIIDSWFDNYXXXXXXX
1darA2          WLVIRTMQERLGARPVVMQLGREDTFSGIIDVLR------------------------------------
1n0uA2          QVSKEDLYQTFA----------------------------------------------------------
1h2tC3          LKIEVFVQTLLHL--------AAKSFSHSFSALAKFHEVFKTLAESDEGKLHVLMFEVWRHPQMIAVLVD
1n0uA5          ----------------------------------------------------------------------
1wdtA2          ALLEDLRSTLGPILPIDLPLYEGGKWVGLIDVFHGKAYRYEN----------------------------
1f60A3          SRFQEIVKETVGYNPKTVVPISGWNGDNMIEATTNAPWYKGWEKET------------------------
1darA4          ----------------------------------------------------------------------
1eniA           IELIAECLKRGFNIKDTTVQPHEASIAISQARLDEKIAQRPTWYKYYGKAIYA-----------------
1vfgA2          ----------------------------------------------------------------------
1nriA           ADIAIETIVGPEILTGSSKSGTAQKXVLNXLTTASXILLGKCYENLXVDVQASN----------------
1puiA           RKALNMVREAVLAFNGDVQTFSSLKKQGVDKLRQKLD---------------------------------
1aipA3          DLVEMEVRDLFPGDEVPVIRGSALLALEQMHRNPKTRRGENEWVDKIWELLDAID---------------
1o94C           KAVIRRELEGGML---QEVEINCPAVLT---IQLGINKPRYASLRGIKQAATKPIEEVSLADIGLSANDV
1lnzA2          NLEAFKEKLTDDYPVF---PISAVTREGLRELLFEVANQLENTPEFPLYDEEEL----------------
1q4rA           ----------------------------------------------------------------------
1vi7A2          ----------------------------------------------------------------------
1p9qC3          ----------------------------------------------------------------------
2hgjF1          PWVVTLAPEVYDIVRTERLVMDLDAWEVFQNRIGG-----------------------------------
1o9nA           LQAAIKAAERAGASVQAIDVHEAWRIHPIIQDFEA-----------------------------------
1h65A           LPYDEFFSKR-----SEALLQVVRSGASLKKDAQASDIPVVLIENSG-----------------------
1n0uA1          -------------------TAQAYRAEQLYEGPADDANCIAIKNCDPKADLMLYVSKMVPTSDGRFYAFG
2cxxA1          EVINFLAEKFEVPLSEIDKVISAKFGDNIERLKNRIFEVIR-----------------------------
1nrjB           PSKIKDALESEIQKVIERRDVLGFKFANLEASVVAFEGSINKRKIS------------------------
1egaA1          DLLPHLQFLASQMNFLDIVPISAETGLNVDTIAAIVRKHLPEAT--------------------------
1zd9A1          EKELIEKMNLSAIQDREICSISCKEKDNIDITLQWLIQH-------------------------------
1wb1A4          IKRTEMIMKSILQSTHNLKPISAKTGFGVDELKNLIITTLNNAE--------------------------
1sulA           WDKHAKVVRQTLNIDPEDELFSSETKKGKDEAWGAIKKMI------------------------------
2fh5B1          AKLIQQLEKELNTL--RVTRSPAQLGKKGKEFEFSQLPLKVE----------------------------
1eg7A           LNLLYELCAKAGAEVA---LSWAKGGEGGLELARKVLQTLESRPSNFHYNLDLSIKDKIAKIATEIYGAD
1g7rA4          VHEGRPFXETFSKQDIQVQPISAITGEGIPELLTXL----------------------------------
2bmjA1          RVVGDARARALCADMKRCSETCATYGLNVDRVFQEVAQKVVTLRKQ------------------------
1wdtA1          -----------------------------------------PTERFGDGPPLAKVFKVQVDPFMGQVAYL
1mkyA1          REVKPELYSLGFGEPI---PVSAEHNINLDTXLETIIKKLEEKGLD------------------------
1upsA2          TSQWQLI---------------------------------------------------------------
1fnmA4          ----------------------------------------------------------------------
1c82A1          TVVRTVRDSMEWMHKHVYNSEKSIVGNWWDYEIGTPRAINNTSDEEIKKYTDVIHFRKTTDNPFKALGGN
1aipA1          ------------------------------------------PVRDVDKPFLMPVEDVFTITGRGTVATG
2b3mA1          ----------------------------------------------------------------------
1mkyA2          KRYDEFTKLFREKLYFIDYFTSADKGWNIDRXIDAXNLAYA-----------------------------
1g7rA2          ------------------------------------------------KPASRLIPKLVFRQSKPAIGGV
1xe1A           --------------------------------------------ILSKKPAGKVVVEEVVNIXGKDVIIG
1zunB1          ------------------------------------------------TDLRFPVQYVNRPNLNFRGFAG
1e0sA           PHEIQEKLGLTRIRDRNWYPSCATSGDGLYEGLTWLTSNY------------------------------
1r5bA1          ------------------------------------------LERKVNAPFIMPIASKYKDLG--TILEG
1darA1          ---------------------------------TTPEGEVVEIHPDPNGPLAALAFKIMADPYVGRLTFI
1n0uA4          ----------------------------------------------------------------------
1g7rA1          ------------------------------------------------SPARGTILEVKEETGLGXTIDA
1xzpA2          EEEIKNKLG-TDR---HMVKISALKGEGLEKLEESIY---------------------------------
2q22A1          ESVRRALILITKLSDYQILDTADEGLLAXKTYSHALGYEEGPVYIKLNGKNGLCYLDSYAGHHRGVLVSC
1wb1A1          ---------------------------------------------NTESYFKMPLDHAFPIKGAGTVVTG
1kjzA1          ------------------------------------------PKRDPNKPPKMLVLRSFPGKLVGGVLDG
1d1nA           ---------------------------------------------------QAEVRQTFKVSKVGTIAGC
121pA           SRQAQDLARSYGI---PYIETSAKTRQGVEDAFYTLVREI------------------------------
1g7dA           ----------------------------------------------------------------------
1f6bA           KG--SVSLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYI------------------------------
1ni3A1          EFVEKHLEGLRKITSRGANTLEXKAKKEEQAIIEKVYQYLTETK--------------------------
2p67A1          VAIARMYESALHIKYDEWQPCSALEKRGIDEIWHAI----------------------------------
1e6vB1          YAAAGLVAAVMVNQ------GAARAAQGVSATILYYNDLLEYETGL------------------------
1p5uB           ---------------------------------------YLTFTSQDGNNHQFTTKVIGKDSR--DFDIS
2c31A3          EADPQPGVIS------------------------------------------------------------
1a2kC           KAKSIVFHRKKNLQYYD---ISAKSNYNFEKPFLWLARK-------------------------------
1t9hA2          ----------------------------------------------------------------------
1agrA2          -------------------FTCATDTKNVQFVFDAVTDVI------------------------------


                         .         .         .         +         .         .         .:280
query           XXXNGTLRPKDKVLLMATGAQHLVEQVGVFSPKSIQRDELTAGQVGFVIAGIKELKAAKVGDTITTMTRR
1darA2          ----------------------------------------------------------------------
1n0uA2          ----------------------------------------------------------------------
1h2tC3          KMIRTQIVDCAAVANFTRLFVWEILHSTIRKMNKHVGAQSEQKNLFLVIFQRFIMILTEHLVRCE--TDG
1n0uA5          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1darA4          ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1o94C           GAAQSMSRVRRMY---------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1vi7A2          ----------------------------------------------------------------------
1p9qC3          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1n0uA1          RVFAGTVKSGQKVRIQGPNYVPGKKDDLVVLMMGRFVEPIDDCPAGNIIGLVGIDQFLLKTGTLT-----
2cxxA1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1wb1A4          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1eg7A           GVNYTAEADKAIQRYESLGYGNLPVVMA-KTQYSFSDDMTKLGRPRNFTITVREVRLPITGAIMTMPGLP
1g7rA4          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
1wdtA1          RLYRGRLKPGDSLQSEAGQVRL----PHLYVPMGKDLLEVEEAEAGFVLGVPK-AEGLHRGMVLWQGEKP
1mkyA1          ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
1fnmA4          ----------------------------------------------------------------------
1c82A1          LVDMGRVKVIAGLLRKD-DQEISSTIRSIEQVFK-LVDQGEGFYDGSYIDHTNVAYTGAYGNVL------
1aipA1          RIERGKVKVGDEVEIVGLAPETRRTVVTGVEMHRKTLQEGIAGDNVGVLLRGVSREEVERGQVLA-----
2b3mA1          ----------------------------------------------------------------------
1mkyA2          ----------------------------------------------------------------------
1g7rA2          EVLTGVIRQGYPLXNDDGETVGTVESXQDKGEN--LKSASRGQKVAXAIKDAVYGKTIHEGDTLYVDIPE
1xe1A           TVESGXIGVGFKVKGPSGI----GGIVRIERNREKVEFAIAGDRIGISIEGK--IGKVKKGDVLE-----
1zunB1          TLASGIVHKGDEIVVLPSGKSSRVKSIVTFEGE--LEQAGPGQAVTLTXEDEIDI---SRGDLLVH----
1e0sA           ----------------------------------------------------------------------
1r5bA1          KIEAGSIKKNSNVLVMPINQTLEVTAIYDEADEEIS-SSICGDQVRLRVRGD--DSDVQTGYVLTS----
1darA1          RVYSGTLTSGSYVYNTTKGRKERVARLLRMHA---NHREEVEELKAGDLGAVVGLKETITGDTLV-----
1n0uA4          ----------------------------------------------------------------------
1g7rA1          VIYDGILRKDDTIAXXTSKDVISTRIRSLLKPRPLKFQKVDEVVAAAGIKVAPGIDDVXAGSPLR-----
1xzpA2          ----------------------------------------------------------------------
2q22A1          QSYYEGGINEXYGHLPL-----------------------------------------------------
1wb1A1          TINKGIVKVGDELKVLPINMSTKVRSIQYFKES--VMEAKAGDRVGMAIQGVD-AKQIYRGXILT-----
1kjzA1          SIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVEEAYPGGVGVGTKLDPYLTKGMAGNVVGKP---
1d1nA           YVTDGKITRDSKVRLIRQGIVVYEGEIDSLKRYKDDVREVAQGYCGLTIKNFNDI---KEGDVIEA----
121pA           ----------------------------------------------------------------------
1g7dA           ----------------------------------------------------------------------
1f6bA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1e6vB1          ----------------------------------------------------------------------
1p5uB           PKVNGENLVGDDVVLATGSQDFFVRSIGSK---GGKLAAGKYTDVTVTVS--------------------
2c31A3          ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1agrA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AEAPLPGFKEVKPQVFAGLYPVESNQYEALRESLEKLRLNDASLQFEPEVSQAXXXXXXXXXXXXXHMEI
1darA2          ----------------------------------------------------------------------
1n0uA2          ----------------------------------------------------------------------
1h2tC3          TSVLTPWYKNC-----------------------------------------------------------
1n0uA5          ----------------------------------------------------------------------
1wdtA2          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1darA4          ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1o94C           ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1vi7A2          ----------------------------------------------------------------------
1p9qC3          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1wb1A4          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1eg7A           KRP-------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
1wdtA1          ESEEVPFAR-------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
1fnmA4          -----------EPVIDVAIEPKTKADQEKLSQALARLAEEDPTFRVSTH---PETGQTIISGMGELHLEI
1c82A1          ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
2b3mA1          ------------------------------------------------------------------KMMS
1mkyA2          ----------------------------------------------------------------------
1g7rA2          NHY-----HILKEQL-------------------------------------------------------
1xe1A           ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
1r5bA1          ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1n0uA4          -----------------------ANDLPKLVEGLKRLSKSDPCVLTYMSESGEHIVAGTGEL----HLEI
1g7rA1          ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
1g7dA           ----------------------------------------------------------------------
1f6bA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1e6vB1          ----------------------------------------------------------------------
1p5uB           ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1agrA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VQERLEREFDMDLITTAPTVVYQVQQRDGTVLTVENPAKMPDPSKIEAILEPIVTVNLYMPQDYVGSVMT
1darA2          ----------------------------------------------------------------------
1n0uA2          ----------------------------------------------------------------------
1h2tC3          ----------------------------------------------------------------------
1n0uA5          --------------------------------------------------EPVFLVEIQCPEQAVGGIYS
1wdtA2          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1darA4          ------------------------------------------------ILEPIMRVEVTTPEEYMGDVIG
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1o94C           ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1vi7A2          ---------------------------------------------------PLTEYTLQCEYHQLTGIEA
1p9qC3          ----------------------------------------------------EMEIAIKIPPEHTGRAIS
2hgjF1          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1wb1A4          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
1fnmA4          IVDRLKREFKVDANVGKPQV--------------------------------------------------
1c82A1          ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
2b3mA1          LLEEMKGIYSKKGGKVKPFEKFEGELKEGYRFEYEKKLCEIDVAMFGLI--SGDLNPVHFDEDF-ASKTR
1mkyA2          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1xe1A           ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
1r5bA1          ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1n0uA4          CLQDLEHDHAGVPLKISPPV--------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
1g7dA           ----------------------------------------------------------------------
1f6bA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1e6vB1          ----------------------------------------------------------------------
1p5uB           ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1agrA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LCTQKRGAQINMSYHGKQVQLTYEIPMAEIVMDFFDRLKSVSRGYASMDYEFKEYRQSDVVKVDILINSD
1darA2          ----------------------------------------------------------------------
1n0uA2          ----------------------------------------------------------------------
1h2tC3          ----------------------------------------------------------------------
1n0uA5          VLNKKRGQVVSEEQTP-LFTVKAYLPVNESF-GFTGELRQATGGQAFPQMVFDHWSTLGSDPLDPTSKAG
1wdtA2          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1darA4          DLNARRGQILGMEPRGNAQVIRAFVPLAEM-FGYATDLRSKTQGRGSFVMFFDHYQEVPKQVQEKLI---
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1o94C           ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1vi7A2          LLGQCDGKIINSDY-QAFVLLRVALPAAKV-AEFSAKLADFSRGSLQLLAIEEE----------------
1p9qC3          ALYNFGGVTREEWQRDGSWICVMRIPSGM-YGDLMDLLGKVAKGEALTKVLR------------------
2hgjF1          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1wb1A4          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
1fnmA4          ----------------------------------------------------------------------
1c82A1          ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
2b3mA1          FGGRVVHGMLTTSLVSAVARLPGTVVLLEQSFRY------------------------------------
1mkyA2          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1xe1A           ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
1r5bA1          ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1n0uA4          ----------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
1g7dA           ----------------------------------------------------------------------
1f6bA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1e6vB1          ----------------------------------------------------------------------
1p5uB           ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1agrA2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           KVDALSVIVHRSNSQYRGREVAAKMREIIPRQMYDVAIQAAIGSNIIARENVKALRKNVLAKCYGGDISR
1darA2          ----------------------------------------------------------------------
1n0uA2          ----------------------------------------------------------------------
1h2tC3          ----------------------------------------------------------------------
1n0uA5          E------IVLAARKRHGMKEEVPGWQEYYDK---------------------------------------
1wdtA2          ----------------------------------------------------------------------
1f60A3          ----------------------------------------------------------------------
1darA4          ----------------------------------------------------------------------
1eniA           ----------------------------------------------------------------------
1vfgA2          ----------------------------------------------------------------------
1nriA           ----------------------------------------------------------------------
1puiA           ----------------------------------------------------------------------
1aipA3          ----------------------------------------------------------------------
1o94C           ----------------------------------------------------------------------
1lnzA2          ----------------------------------------------------------------------
1q4rA           ----------------------------------------------------------------------
1vi7A2          ----------------------------------------------------------------------
1p9qC3          ----------------------------------------------------------------------
2hgjF1          ----------------------------------------------------------------------
1o9nA           ----------------------------------------------------------------------
1h65A           ----------------------------------------------------------------------
1n0uA1          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1nrjB           ----------------------------------------------------------------------
1egaA1          ----------------------------------------------------------------------
1zd9A1          ----------------------------------------------------------------------
1wb1A4          ----------------------------------------------------------------------
1sulA           ----------------------------------------------------------------------
2fh5B1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1g7rA4          ----------------------------------------------------------------------
2bmjA1          ----------------------------------------------------------------------
1wdtA1          ----------------------------------------------------------------------
1mkyA1          ----------------------------------------------------------------------
1upsA2          ----------------------------------------------------------------------
1fnmA4          ----------------------------------------------------------------------
1c82A1          ----------------------------------------------------------------------
1aipA1          ----------------------------------------------------------------------
2b3mA1          ----------------------------------------------------------------------
1mkyA2          ----------------------------------------------------------------------
1g7rA2          ----------------------------------------------------------------------
1xe1A           ----------------------------------------------------------------------
1zunB1          ----------------------------------------------------------------------
1e0sA           ----------------------------------------------------------------------
1r5bA1          ----------------------------------------------------------------------
1darA1          ----------------------------------------------------------------------
1n0uA4          ----------------------------------------------------------------------
1g7rA1          ----------------------------------------------------------------------
1xzpA2          ----------------------------------------------------------------------
2q22A1          ----------------------------------------------------------------------
1wb1A1          ----------------------------------------------------------------------
1kjzA1          ----------------------------------------------------------------------
1d1nA           ----------------------------------------------------------------------
121pA           ----------------------------------------------------------------------
1g7dA           -LPAYDALAGQFIEASSREARQAILKQG-QDGLSGVKETDKKWASQYLKGKILDQGEDFPAS----ELAR
1f6bA           ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1e6vB1          ----------------------------------------------------------------------
1p5uB           ----------------------------------------------------------------------
2c31A3          ----------------------------------------------------------------------
1a2kC           ----------------------------------------------------------------------
1t9hA2          ----------------------------------------------------------------------
1agrA2          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXXXXXRMKQVGTVEIPQEAFLAxxxxxxx
1darA2          -------------------------------------
1n0uA2          -------------------------------------
1h2tC3          -------------------------------------
1n0uA5          -------------------------------------
1wdtA2          -------------------------------------
1f60A3          -------------------------------------
1darA4          -------------------------------------
1eniA           -------------------------------------
1vfgA2          -------------------------------------
1nriA           -------------------------------------
1puiA           -------------------------------------
1aipA3          -------------------------------------
1o94C           -------------------------------------
1lnzA2          -------------------------------------
1q4rA           -------------------------------------
1vi7A2          -------------------------------------
1p9qC3          -------------------------------------
2hgjF1          -------------------------------------
1o9nA           -------------------------------------
1h65A           -------------------------------------
1n0uA1          -------------------------------------
2cxxA1          -------------------------------------
1nrjB           -------------------------------------
1egaA1          -------------------------------------
1zd9A1          -------------------------------------
1wb1A4          -------------------------------------
1sulA           -------------------------------------
2fh5B1          -------------------------------------
1eg7A           -------------------------------------
1g7rA4          -------------------------------------
2bmjA1          -------------------------------------
1wdtA1          -------------------------------------
1mkyA1          -------------------------------------
1upsA2          -------------------------------------
1fnmA4          -------------------------------------
1c82A1          -------------------------------------
1aipA1          -------------------------------------
2b3mA1          -------------------------------------
1mkyA2          -------------------------------------
1g7rA2          -------------------------------------
1xe1A           -------------------------------------
1zunB1          -------------------------------------
1e0sA           -------------------------------------
1r5bA1          -------------------------------------
1darA1          -------------------------------------
1n0uA4          -------------------------------------
1g7rA1          -------------------------------------
1xzpA2          -------------------------------------
2q22A1          -------------------------------------
1wb1A1          -------------------------------------
1kjzA1          -------------------------------------
1d1nA           -------------------------------------
121pA           -------------------------------------
1g7dA           ISKLIENKMSEGKKEELQRSLNI-LTAFRK-------
1f6bA           -------------------------------------
1ni3A1          -------------------------------------
2p67A1          -------------------------------------
1e6vB1          -------------------------------------
1p5uB           -------------------------------------
2c31A3          -------------------------------------
1a2kC           -------------------------------------
1t9hA2          -------------------------------------
1agrA2          -------------------------------------