[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF09433.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b92A.bssp"

## Summary of PDB Search
:278
    9e-05  13%  1b92A  [c.55.3.2] PROTEIN (INTEGRASE)
:278

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b92A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1b92A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSDNGSAYIDHRTRSFARELGLEPLTTPV
1b92A           ------------------------------------------TDNGSNFTSTTVKAACWWAGIKQEFGAV


                         .         .         .         +         .         .         .:280
query           RSPQSNGMAESFVKTMKRDYIAFMNKPDVPTALSQLTVAFEQYNDWHPHKALKYRSPREFRxxxxxxx
1b92A           IESMNKELKKIIGQVRDQA---EHLKTAVQMAV-------FIHNGYSAGERIVDIIATDIQ-------