[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF09441.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1pjrA1.bssp"
#ERROR : Can't open dsspfile "1fuuA.bssp"
#ERROR : Can't open dsspfile "1hv8A1.bssp"
#ERROR : Can't open dsspfile "1wzuA1.bssp"
#ERROR : Can't open dsspfile "1gkuB1.bssp"
#ERROR : Can't open dsspfile "1ig3A2.bssp"
#ERROR : Can't open dsspfile "2fwrA1.bssp"
#ERROR : Can't open dsspfile "1wp9A2.bssp"
#ERROR : Can't open dsspfile "2p6rA4.bssp"
#ERROR : Can't open dsspfile "1pdoA.bssp"
#ERROR : Can't open dsspfile "2g2jA1.bssp"
#ERROR : Can't open dsspfile "1rybA.bssp"
#ERROR : Can't open dsspfile "1jr6A.bssp"
#ERROR : Can't open dsspfile "1c4oA2.bssp"
#ERROR : Can't open dsspfile "1oywA3.bssp"
#ERROR : Can't open dsspfile "1t5iA.bssp"
#ERROR : Can't open dsspfile "1qhh.1.bssp"
#ERROR : Can't open dsspfile "1kyqA2.bssp"
#ERROR : Can't open dsspfile "1gm5A4.bssp"
#ERROR : Can't open dsspfile "2p6rA3.bssp"
#ERROR : Can't open dsspfile "2eyqA5.bssp"
#ERROR : Can't open dsspfile "1w36B2.bssp"
#ERROR : Can't open dsspfile "1z3iX2.bssp"
#ERROR : Can't open dsspfile "1a1vA2.bssp"
#ERROR : Can't open dsspfile "1z3iX1.bssp"
#ERROR : Can't open dsspfile "1rifA.bssp"
#ERROR : Can't open dsspfile "1m6nA3.bssp"
#ERROR : Can't open dsspfile "1a1vA1.bssp"
#ERROR : Can't open dsspfile "1m6nA4.bssp"
#ERROR : Can't open dsspfile "1wp9A1.bssp"
#ERROR : Can't open dsspfile "1nktA4.bssp"
#ERROR : Can't open dsspfile "1gkuB2.bssp"
#ERROR : Can't open dsspfile "1oywA2.bssp"
#ERROR : Can't open dsspfile "1b6rA1.bssp"
#ERROR : Can't open dsspfile "1yksA1.bssp"
#ERROR : Can't open dsspfile "1z5zA1.bssp"
#ERROR : Can't open dsspfile "1c7sA1.bssp"
#ERROR : Can't open dsspfile "1iibA.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "2eyqA2.bssp"
#ERROR : Can't open dsspfile "2nwuA1.bssp"
#ERROR : Can't open dsspfile "2fwrA2.bssp"
#ERROR : Can't open dsspfile "2eyqA3.bssp"
#ERROR : Can't open dsspfile "1ng5A.bssp"
#ERROR : Can't open dsspfile "1w36D1.bssp"
#ERROR : Can't open dsspfile "1gm5A3.bssp"
#ERROR : Can't open dsspfile "1g8eA.bssp"
#ERROR : Can't open dsspfile "2bhrA2.bssp"
#ERROR : Can't open dsspfile "2hv2A2.bssp"
#ERROR : Can't open dsspfile "1zb6A1.bssp"
#ERROR : Can't open dsspfile "1w36B1.bssp"
#ERROR : Can't open dsspfile "2eyqA3.bssp"
#ERROR : Can't open dsspfile "1gm5A3.bssp"

## Summary of PDB Search
:634
    2e-52  12%  1pjrA1 [c.37.1.19] PCRA A:1 -- 318
    2e-49  33%  1fuuA  [c.37.1.19] YEAST INITIATION FACTOR 4A
    5e-44  36%  1hv8A1 [c.37.1.19] PUTATIVE ATP-DEPENDENT RNA HELICASE MJ0669 A:3
    4e-38  12%  1wzuA1 [c.145.1.1] QUINOLINATE SYNTHETASE A A:1 -- 298
    6e-38  20%  1gkuB1 [c.37.1.16] REVERSE GYRASE B:1 -- 250
    2e-37   7%  1ig3A2 [c.100.1.1] THIAMIN PYROPHOSPHOKINASE A:10 -- 178
    8e-34  21%  2fwrA1 [c.37.1.19] DNA REPAIR PROTEIN RAD25 A:257 -- 456
    5e-33  20%  1wp9A2 [c.37.1.19] ATP-DEPENDENT RNA HELICASE, PUTATIVE A:201 --
    1e-30  21%  2p6rA4 [c.37.1.19] AFUHEL308 HELICASE A:203 -- 403
    4e-30  15%  1pdoA  [c.54.1.1] MANNOSE PERMEASE
    2e-29  34%  2g2jA1 [c.37.1.19] ATP-DEPENDENT RNA HELICASE DDX25 A:307 -- 474
    2e-29  12%  1rybA  [c.56.3.1] CRS2
    2e-28  28%  1jr6A  [c.37.1.14] HELICASE NS3
    6e-28  22%  1c4oA2 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:410
    9e-28  25%  1oywA3 [c.37.1.19] ATP-DEPENDENT DNA HELICASE A:207 -- 406
    8e-27  29%  1t5iA  [c.37.1.19] C_TERMINAL DOMAIN OF A PROBABLE ATP-DEPENDENT
    2e-26  12%  1qhh.1 [c.37.1.19] PROTEIN (PCRA (SUBUNIT)) A:- -- - B:- -- - C:-
    8e-26  12%  1kyqA2 [e.37.1.1] SIROHEME BIOSYNTHESIS PROTEIN MET8 A:151 -- 273
    4e-25  24%  1gm5A4 [c.37.1.19] RECG A:550 -- 755
    5e-25  20%  2p6rA3 [c.37.1.19] AFUHEL308 HELICASE A:1 -- 202
    6e-25  24%  2eyqA5 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:779 --
    3e-24   7%  1w36B2 [c.37.1.19] EXODEOXYRIBONUCLEASE V BETA CHAIN B:486 -- 880
    5e-24  11%  1z3iX2 [c.37.1.19] SIMILAR TO RAD54-LIKE X:92 -- 389
    5e-24  14%  1a1vA2 [c.37.1.14] PROTEIN (NS3 PROTEIN) A:326 -- 624
    1e-23  14%  1z3iX1 [c.37.1.19] SIMILAR TO RAD54-LIKE X:390 -- 735
    8e-23  14%  1rifA  [c.37.1.23] DNA HELICASE UVSW
    2e-22  22%  1m6nA3 [c.37.1.19] PREPROTEIN TRANSLOCASE SECA A:1 -- 226 A:349 --
    6e-22  17%  1a1vA1 [c.37.1.14] PROTEIN (NS3 PROTEIN) A:190 -- 325
    8e-22  18%  1m6nA4 [c.37.1.19] PREPROTEIN TRANSLOCASE SECA A:396 -- 570
    1e-21  20%  1wp9A1 [c.37.1.19] ATP-DEPENDENT RNA HELICASE, PUTATIVE A:1 -- 200
    2e-21  14%  1nktA4 [c.37.1.19] PREPROTEIN TRANSLOCASE SECA 1 SUBUNIT A:397 --
    3e-19  10%  1gkuB2 [c.37.1.16] REVERSE GYRASE B:251 -- 498
    3e-17  28%  1oywA2 [c.37.1.19] ATP-DEPENDENT DNA HELICASE A:1 -- 206
    3e-17  18%  1b6rA1 [b.84.2.1] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE
    6e-16  18%  1yksA1 [c.37.1.14] GENOME POLYPROTEIN [CONTAINS: FLAVIVIRIN A:185
    3e-15  15%  1z5zA1 [c.37.1.19] HELICASE OF THE SNF2/RAD54 FAMILY A:663 -- 906
    4e-15  13%  1c7sA1 [b.1.18.2] BETA-N-ACETYLHEXOSAMINIDASE A:781 -- 885
    3e-14  22%  1iibA  [c.44.2.1] ENZYME IIB OF THE CELLOBIOSE-SPECIFIC
    4e-14  10%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    5e-14  12%  2eyqA2 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:349 --
    8e-14   7%  2nwuA1 [d.77.1.2] UPF0201 PROTEIN SSO1042 A:3 -- 144
    8e-14  23%  2fwrA2 [c.37.1.19] DNA REPAIR PROTEIN RAD25 A:23 -- 256
    7e-13  29%  2eyqA3 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:546 --
    1e-11   8%  1ng5A  [b.100.1.1] SORTASE B
    2e-08  21%  1w36D1 [c.37.1.19] EXODEOXYRIBONUCLEASE V ALPHA CHAIN D:2 -- 360
    7e-08  21%  1gm5A3 [c.37.1.19] RECG A:286 -- 549
    1e-06  22%  1g8eA  [a.145.1.1] FLAGELLAR TRANSCRIPTIONAL ACTIVATOR FLHD
    1e-05  23%  2bhrA2 [c.37.1.14] RNA HELICASE A:178 -- 482
    2e-05   5%  2hv2A2 [d.108.1.10] HYPOTHETICAL PROTEIN A:2 -- 286
    5e-04  13%  1zb6A1 [d.313.1.1] AROMATIC PRENYLTRANSFERASE A:3 -- 303
    8e-04  26%  1w36B1 [c.37.1.19] EXODEOXYRIBONUCLEASE V BETA CHAIN B:1 -- 485
    3e-04  13%  2eyqA3 [c.37.1.19] TRANSCRIPTION-REPAIR COUPLING FACTOR A:546 --(query 323->367)
    2e-05  23%  1gm5A3 [c.37.1.19] RECG A:286 -- 549(query 311->367)
:634

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDAMLNADAAPAVEASENGFAKLGLDAAILRALAEANYN
1pjrA1          ------------------------------------------------------------MNFLSEQLLA
1fuuA           --------------------------------------------------FDDXELDENLLRGVFGYGFE
1hv8A1          --------------------------------------------------FNELNLSDNILNAIRNKGFE
1wzuA1          --------------------------------------------------NYQLPEVQDIADFIGDSLEL
1gkuB1          -------------------------------------AAAAAAAAASLCLFPEDFLLKEFVEFFRK-CVG
1ig3A2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1pdoA           ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1jr6A           ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
1qhh.1          ------------------------------------------------------------MNFLSEQLLA
1kyqA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2p6rA3          --------------------------------------------------VEELAESI-SSYAVGILKEE
2eyqA5          ----------------------------------------------------------------------
1w36B2          ----------------------------------------------------------------------
1z3iX2          ----------------------------------------------KEKLPVHVVVDPVLSKVLRPHQRE
1a1vA2          ----------------------------------------------------------------------
1z3iX1          ----------------------------------------------------------------------
1rifA           --------------------------------------------------RKDFDEWLSKLEIYSGNKRI
1m6nA3          --------------------------------DDALKHKTIEFKERLEKGATTDDLLVEAFAVVREASRR
1a1vA1          ----------------------------------------------------------------------
1m6nA4          ----------------------------------------------------------------------
1wp9A1          ---------------------------------------------------------------VLRRDLI
1nktA4          ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
1oywA2          -----------------------------------------------------LNLESGAKQVLQETGYQ
1b6rA1          ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1iibA           --------------------------------------------------FSSAGMSTSLLSKMRAQAEK
1c4oA1          --------------------------------------------------------------------GD
2eyqA2          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
2eyqA3          ---------------------------------------------AAKEGFA-FKHDREQYQLFCDSFPF
1ng5A           ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1g8eA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
2hv2A2          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1w36B1          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TPTPVQAQAIPAFLAGRDLLVSSQTGSGKTAAFMLPAIQRISEKPATHRPTEPAKRMKGKRPRPSPAQPS
1pjrA1          HLNKEQQEAVR--TTEGPLLIMAGAGSGKTRVLTHRIAYLMAEKHVAP--------------------WN
1fuuA           EPSAIQQRAIXPIIEGHDVLAQAQSGTGKTGTFSIAALQRI---------------------DTSVKAPQ
1hv8A1          KPTDIQXKVIPLFLNDYNIVAQARTGSGKTASFAIPLIELVNENN----------------------GIE
1wzuA1          ARRATRVDADVIVFAGVDFMAETAKILNPDKVVLIPSVEHI-----------------LEAKRKYPNAPV
1gkuB1          EPRAIQKMWAKRILRKESFAATAPTGVGKTSFGLAMSLFLA------------------------LKGKR
1ig3A2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1pdoA           ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1jr6A           ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
1qhh.1          HLNKEQQEAVR--TTEGPLLIMAGAGSGKTRVLTHRIAYLMAEKHV--------------------APWN
1kyqA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2p6rA3          ELFPPQAEAVEKVFSGKNLLLAMPTAAGKTLLAE------------------------MAMVREAIKGGK
2eyqA5          ----------------------------------------------------------------------
1w36B2          ----------------------------------------------------------------------
1z3iX2          GVKFLDCVTGRRIENSYGCIMADEMGLGKTLQCITLIWTLLKQSPDCKPE-----------------IDK
1a1vA2          ----------------------------------------------------------------------
1z3iX1          ----------------------------------------------------------------------
1rifA           EPHWYQKDAVFEGLVNRRRILNLPTSAGRSLIQALLARYYLENYEGKIL---------------------
1m6nA3          VMFPFKVQLMGGVALHDGNIAEMKTGEGKTLTSTLPVYLNA---------------LTGKG---------
1a1vA1          ----------AVPQSFQVAHLHAPTGSGKSTKVPAAYAAQG---------------------------YK
1m6nA4          ----------------------------------------------------------------------
1wp9A1          QPRIYQ-EVIYAKCKETNCLIVLPTGLGKTLIAMMIAEYRLTKYGGKVLM--------------------
1nktA4          ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
1oywA2          QFRPGQEEIIDTVLSGRDCLVVXPTGGGKSLCYQIPALLL---------------------------NGL
1b6rA1          ----------------------------------------------------------------------
1yksA1          -----------MLKKGMTTVLDFHPGAGKTRRFLPQILAECARRRLRTL---------------------
1z5zA1          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1iibA           YEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPV-----------------------
1c4oA1          QPKAIAGLVEALRDGERFVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQLAAEFRELFPENAV
2eyqA2          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2fwrA2          SLRDYQEKALERWLVDKRGCIVLPTGSGKTHVAMAAINELSTPT--------------------------
2eyqA3          ETTPDQAQAINAVLSAMDRLVCGDVGFGKTEVAMRAAFLAV---------------DNHKQ---------
1ng5A           ----------------------------------------------------------------------
1w36D1          -EINWQKVAAAVALTRRISVISGGPGTGKTTTVAKLLAALI-------------QMADGERCR-------
1gm5A3          KLTNAQKRAHQEIRNPMNRLLQGDVGSGKTVVAQLAILDNY---------------EAGF---------Q
1g8eA           ----------------------------------------------------------------------
2bhrA2          ---------------KRLTIMDLHPGAGKTKRY-LPAIVR-----------EAIKR--GLR---------
2hv2A2          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1w36B1          SDVAETLDPLRLPLQGE-RLIEASAGTGKTAALYLRLLLGLGGS---------AAFPRPLTVE------E
2eyqA3          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LLVLTPTRELALQVTEAAAKYGRHLRRIVCASILGGMPYPKQLAMLARMPDILVATPGRLLDHIEAGRID
1pjrA1          ILAITFTNKAAREMRERVQSLLGGAAEDVWISTFHSM---CVRILRRDIDRIGINRNFSILDPTDQLSVM
1fuuA           ALXLAPTRELALQIQKVVXALAFHXD-IKVHACIGGTSFVEDAEGL-RDAQIVVGTPGRVFDNIQRRRFR
1hv8A1          AIILTPTRELAIQVADEIESLKGNKNLKIA-KIYGGKAIYPQIKAL-KNANIVVGTPGRILDHINRGTLN
1wzuA1          VLYVNST------------------AEAKAYADVTVTSANAVEVVKKLDSDVVIFGPDKNLAHYVAKMTG
1gkuB1          CYVIFPTSLLVIQAAETIRKYAEKAGVGTLIGYYHGRIPKREKENFLRNFKIVITTTQFLSKHYRELGVD
1ig3A2          -SGLVPRGSHMEHAFTPLEPLLPTGN-LKYCLVVLNQPLDARFRHLWKKALLRACADGGANHLYDLTEGE
2fwrA1          ----------------------------------------------------------------------
1wp9A2          -WVRVDLPEIYKEVRKLLREMLRDLKPLAETGLLESSS-------PDIPKKEVLRAGQIINEEMAKGGLL
2p6rA4          ----------------------------------------------------------------------
1pdoA           --------------------------------------------------AIVIGTHGWAAEQLLAEMLL
2g2jA1          ----------------------------------------------------------------------
1rybA           -------------------------------------------------PWLIAGLPGNKYYGT------
1jr6A           ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
1qhh.1          ILAITFTNKAAREMRERVQSLLGGAAEDVWISTFH---SMCVRILRRDIDRIGINRNFSILDPTDQLSVM
1kyqA2          ------NLEIGDRLQILISTNGLSPR---FGALVRDEIRNLFTQXGDLALEDAVVKLGELRRGIRLLAPD
1gm5A4          ----------------------------------------------------------------------
2p6rA3          SLYVVPLRALAGEKYESFKKWEKIGLRIGI-----STGDYESRDEHLGDCDIIVTTSEKADSLIRNRASW
2eyqA5          ----------------------------------------------------------------------
1w36B2          ----------------------------------------------------------------------
1z3iX2          VIVVSPSSLVRNWYNEVGKWLGGRV-QPVAIDGGSKDEIDSKLVNFISQQPTPILIISYETFRLHAEVLH
1a1vA2          ----------------------------------------------------------------------
1z3iX1          ----------------------------------------------------------------------
1rifA           --IIVPTTALTTQMADDFVDYRLFSHAMIK----KIGGGASKDDKYKNDAPVVVGTWQTVVKQPKEWFSQ
1m6nA3          VHVVTVNEYLASRDAEQMGKIFEFL-GLTVGLNLNSMSKDEKREAYA--ADITYSTNNELGFDYYKEQMV
1a1vA1          VLVLNPSVAATLGFGAYMSKAHGVDPNIR-----------TGVRTITTGSPITYSTYGKFLADGGXSGGA
1m6nA4          ----------------------------------------------------------------------
1wp9A1          ---LAPTKPLVLQHAESFRRLFNLPPEKIVALTGEKSP--EERSKAWARAKVIVATPQTIENDLLAGRIS
1nktA4          ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
1oywA2          TVVVSPLISLXKDQVDQLQANG-----VAAACLNSTQTREQQLEVXTGCIRLLYIAPERLLEHLAHWNPV
1b6rA1          ----------------------------------------------------------------------
1yksA1          --VLAPTRVVLSEMKEAFHGLDVKFHTQAFSAH-------------GSGREVIDAMCHATLTYRMLEPTR
1z5zA1          -------------------------------------------------------------------YCN
1c7sA1          ----------------------------------------------------------------------
1iibA           --EVIDSLLYGKVDGLGV----------------------------------------------------
1c4oA1          EYFISYYDYYQ-PEAYVPGKDLYIEKDASINPEIERLRHSTTRSLLTRRDVIVVASVSAIYGLGDPREYR
2eyqA2          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2fwrA2          -LIVVPTLALAEQWKERLGIFGEEYVGEFSGRI-------------KELKPLTVSTYDSAYVNAEKLGNR
2eyqA3          VAVLVPTTLLAQQHYDNFRDRNWPVRIEMISRFRSAKEQTQILAEVAEKIDILIGTHKLLQSDVK-----
1ng5A           -----MLMSKHQAHVRPQFESLEKINWIKLSGTSLNYPVLQGKTNHDYLNLDFEREHRRKGSIFMDFRNE
1w36D1          IRLAAPTGKAAARLTESLGKALRQL-PLTDEQKKRIPEDASTLHRLLHAGNPL---HLDVLVVDEASMID
1gm5A3          TAFMVPTSILAIQHYRRTVESKFNIHVALLIGATTPSEKEKIKSGLRNQIDVVIGTHALIQEDVHFKNLG
1g8eA           ---------------------------------------------------------SELLKHIYINLSY
2bhrA2          TLILAPTRVVAAEMEEAPIRYQREIVDLMCHATFTM----------------------RLLSPIR-----
2hv2A2          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1w36B1          LLVVTFTE--------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           LSALEMLVFDEADRMLDMGFADDIDAIVAATPASRQTLMFSATLDARIAQLASRQLRDPQRIEIAAARAD
1pjrA1          KTILKEKNIDPKKFEPRTILGTISAAKNELLPPEQFAKRYYEKVVSDVYQEYQQRLLRNHSLDFDDLIMT
1fuuA           TDKIKXFILDEADEXLSSGFKEQIYQIFTLLPPTTQVVLLSATXPNDVLEVTTKFXRNPVRILV------
1hv8A1          LKNVKYFILDEADEXLNXGFIKDVEKILNACNKDKRILLFSATXPREILNLAKKYXGDYSFIKA------
1wzuA1          KKIIPVFTLDDVERAKKLHPNAKLMIH----PECIPEVQEKADIIASTGGMIKRACEWDEWVV-------
1gkuB1          DVDAILKASKNVDKLLHLGFHYDLKTKSWVGEARGCLMVSTATAKKGKKAEL---FRQLLNFDIGSSR--
1ig3A2          RESFVSGDFDSIRPEVKEYYTKKGCDLI--STPDQDHTDFTKCLQVLQRKIEEKELQVDVIVTLGGLGGR
2fwrA1          ----KHLAKYTIKRIFVPLAEDERV------EYEKREKVYKQFLRARGITLRRAEDFNKIVMDERAYEAL
1wp9A2          LYHAMALKLHHAIELLETQGLSALRAYIKKLYEEAKA----GSTKASKEIFSDKRMKKAISLLV------
2p6rA4          ---------------------PLVEGVLCEGTLELFDGAFSTSRRVKFEELVEECVAENGGV--------
1pdoA           GEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTKGVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNI
2g2jA1          ----------------------------------------------------------------------
1rybA           RHNVGFEMVDRIAAEEGITMNTIQSKS--------LLGIGSIGEVPVLVVKPQSYMNYSGEAIGPLAAYY
1jr6A           ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
1qhh.1          KTILKEKNIDPKKFEPRTILGTISAAKNELLPPEQFAKRYYEKVVSDVYQEYQQRLLRNHSLDFDDLIMT
1kyqA2          DKDVKWARRCTDLFGIQHCHNIDVKRLLDLFKVXFQEQNCSLQFPPRERLLS------------------
1gm5A4          ----------------------------------------------------------------------
2p6rA3          IKAVSCLVVDEIHLLDSEKRGATLEILVTRMNKALRVIGLSATAP-NVTEIAEWLDADYYVSDW------
2eyqA5          ----------------------------------------------------------------------
1w36B2          ------------------------LRFVFKGETQPAMKMWLMEGESCGVGDY----------QSTMAQVC
1z3iX2          KGKVGLVICDEGHRLKNSDN--QTYLALNSMNAQRRVLISGTPIQNDLLEYFSLVHFVNSGILG------
1a1vA2          ----------------------------------------------------------PGSVT-----VP
1z3iX1          ----------------------------------------------------------------------
1rifA           ---FGMMMNDECHLA----TGKSISSIISGLNNCMFKFGLSGSLRDGKANIMQYGMFGE-----------
1m6nA3          QRPLHFAVIDEVDSIIDEARTPLIISGQSMTLATITFQNY------------------------------
1a1vA1          YDIIICDECHSTDATSILGI--GTVLDQAETAGARLVVLATAT---------------------------
1m6nA4          ----------------------------------------------------------------------
1wp9A1          LEDVSLIVFDEAHRAVGNYAYVFIAREYKRQAKNPLVIGLTASPGSTPEKIMEVINNLG-IEHIEYRSEN
1nktA4          ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
1oywA2          L-----LAVDEAHCISQWGH--------------------------------------------------
1b6rA1          ----------------------------------------------------------------------
1yksA1          VVNWEVIIMDEAHFLDPASIAARGWAAHRARANESATILMTATP--------------------------
1z5zA1          LTPEQAAMYKAEVE-------NLFNNIDSVTGIKRKGMILSTLLKLK---------------QIVDHPAL
1c7sA1          ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
1c4oA1          ARNLVGFVLFPATHYLSPEGLEEILKEIEKELWERVRYFEERGEVLYAQRLKERTLYDLEMLRVMGTCPG
2eyqA2          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2fwrA2          FM---LLIFDEVHHL----PAESYVQIAQMSIA-PFRLGLTATFDGRHEILK--EVVGGKVFEL------
2eyqA3          FKDLGLLIVDEEHR-----FGVRHKERIKAMRANVDILTLTATPIPRTLNMAMSGMRD------------
1ng5A           LKNLNHNTILYGHHVGDNTMFDVLEDYLKQSFYEKHKIIEFDNKYGKYQQVFSAYKTTTKDNYI-RTDFE
1w36D1          LPMMSRLILPDHARVIFLGDRDQLASVEAGAVLGDICAYANAGFTAERARQLSRLT--GTHVPAGTGTEA
1gm5A3          L-----VIIDEQHRFEAL----------MNKGKMVDTLVMSATPIPRSMALAFYGDLDVTVID-------
1g8eA           LLAQRLIVQDKASAMFRLGINEEMTTLAALTLPQMVKLAETNQLVCHFRFDSHQTI--------------
2bhrA2          VPNYNLIIMDEAHFT-------DPASIAARGYISTRVEMGEAAGIFMTATPPGSRDPFPQSNAPIMDEER
2hv2A2          ------------------------------------------------------KDVYLENQRAHSGGVI
1zb6A1          ----------------------------------------------------------------------
1w36B1          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           HSNIEQRLHFTDDMSHKERLLDHLLRDASLKQAIVFTATKRDADSLAERLSDTGFSAGALHGDMTQGARN
1pjrA1          TIQLFDRVPDVYYQYKFQYIHIDEYQDTNRAQYTLVKKLAERFQ--NICAVGDADQSIYRWRGADIQNIL
1fuuA           ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
1wzuA1          ---------------FTEREMVYRLRKLYPQKKFYPAREDAFCAITLKNYESLKDMKYKVEVPEEIARKA
1gkuB1          ----------------------------------------------------------------------
1ig3A2          FDQIMASVNTLFQATHITPVPIIII---------------------------------------------
2fwrA1          RAWEEARRIAFN-SKNKIRKLREILERHRKDKIIIFTRHNELVYRISKVFLIPAI-----THRTSREERE
1wp9A2          --QAKEIGLDHPKMDKLKEIIREQLQRKQNSKIIVFTNYRETAKKIVNELVKDGIKAKRFVGQASQREQK
2p6rA4          LVFESTRRGAEKTAVKLSAITAKYVENEGLEKAILEENEGEMSRKLAECV---RKGAAFHHAGLLNGQRR
1pdoA           PMLVETLMARDDDP-SFDELVALAV-ETGREGVKAL----------------------------------
2g2jA1          LNNIRQYYVLCEHRKDKYQALCNIYGSITIGQAIIFCQTRRNAKWLTVEMIQDGHQVSLLSGELTVEQRA
1rybA           QVPLRHILLIYDDTSLPN----GVLRLQKKGGHGRHNGLQNVIEHLDGRREFPRLSIGIGSPPGKMDPRA
1jr6A           HPNIEEVALSTTPFYGKAIPLEVI----KGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVI-
1c4oA2          -TGLLDPLVRVKPTENQILDLMEGIREARGERTLVTVLTVRMAEELTSFLVEHGIRARYLHHELDAFKRQ
1oywA3          FDRPNIRYXLXEK-FKPLDQLXRYVQEQRGKSGIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRA
1t5iA           ---LQQYYVKLKD-NEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERL
1qhh.1          TIQLFDRVPDVLHYYQYKFQYIHIDEYQDTNRAQYTLVKKLAERFQNICAVGDADQSIYRWRGADIQNIL
1kyqA2          ----------------------------------------------------------------------
1gm5A4          ---RKEVQTMLVP-MDRVNEVYEFVRQEVMRQAFIVYPLIKSAVEMYEYLSKEVFKLGLMHGRLSQEEKD
2p6rA3          ----------------------------------------------------------------------
2eyqA5          --AVKTFVREYDSMVVREAILREILRG---GQVYYLYNDVENIQKAAERLAELVPEAAIGHGQMRERELE
1w36B2          AAQIRDWLQAGQRG-EALLMNGDDARPVRASDISVLVRSRQEAAQVRDALTLLEIPSVYLSNRDSVFETL
1z3iX2          ----------------------------------------------------------------------
1a1vA2          HPNIEEVALSTTG-EIPFYGKAIPLEVIKGGRHLIFCHSKKKCDELAAKLVALGINAVAYYRGLDVSVIP
1z3iX1          ------------QLSGKMLVLDYILRTTTSDKVVLVSNYTQTLDLFEKLCRNRRYLYVRLDGTMSIKKRA
1rifA           ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1m6nA4          ---DRPDLIYRTM-EGKFKAVAEDVAQRYMTPVLVGTVAVETSELISKLLKNKGIPHQVLNAKNHEREAQ
1wp9A1          SPDVRPYV--------------------------------------------------------------
1nktA4          --REDQSDLIYKTEEAKYIAVVDDVAERYAKPVLIGTTSVERSEYLSRQFTKRRIPHNVLNAKYHEQEAT
1gkuB2          ---VRNVEDVAVNDESISTLSSIL--EKLGTGGIIYARTGEEAEEIYESLKN------KFRIGIVTATKK
1oywA2          ----------------------------------------------------------------------
1b6rA1          ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1z5zA1          LKGGEQSVRRSGKMIRTMEIIEEA--LDEGDKIAIFTQFVDMGKIIRNIIEKENTEVPFLYGELSKKERD
1c7sA1          ----------------------------------------THFVDTQALEKDRFANILGQRELAKLDKGG
1iibA           ----------------------------------------------------------------------
1c4oA1          VENYARYFTGKAPGEPPYTLLDYFPEDFLVFLDESHVTVPQLQGMYRGDYARKKTLVDYGFRLPSALDNR
2eyqA2          ---------------QQKAPLDALRKETFDGPVVFSVESEGRREALGELLARIKIAPQRIM---------
2nwuA1          ----------------------------------PSEDVNKVLSAISNFFDFEKXNTGIIDILVLEARTL
2fwrA2          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1ng5A           NDQDYQQFLDETK---------------------------------------------------------
1w36D1          ASLRDSLCLLQ-----------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1g8eA           ----------------------------------------------------------------------
2bhrA2          EIPERSWNSGHEWVTDFK------------GKTVWFVPSIKAGNDIAACLRKNGKKVIQLSR----KTFD
2hv2A2          RETWWLDYTLNRA-SKPNNQAIYYSSEGKAEGYVIYRIAAGTFEYLTNTAFKALAGFIGSHSGSVQSFHW
1zb6A1          -------------------------------------IPSMPPA-VAENAELARYGLDKVQMTSMDYKKR
1w36B1          ----------------------------------------------------------------------
2eyqA3          ------------------------------------------YDNFRDRFANWPVRIEMISRFRSAKEQT
1gm5A3          ------------------------------FQTAFMVPTSILARRTVESFSKFNIHVALLIGATTPSEKE


                         .         .         .         .         *         .         .:420
query           RTLTALRRGNLRVLVATDVAARGIDVPDITHVVNFDLPKQAEDYVHRIGRTGRAGRSGVAINLVNHGDMF
1pjrA1          SFE-----------------RDYPNAKVILLEQNYRSTKRILQAANEVIEHNVNRKPKRIWTENPEG---
1fuuA           ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
1wzuA1          RKAIERMLE-------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
2fwrA1          EILEGFRTGRFRAIVSSQVLDEGIDVPDANVGVIMSGSGSAREYIQRLGRILRPSKGKKEAVLYE-----
1wp9A2          LILDEFARGEFNVLVATSVGEEGLDVPEVDLVVFYEPVPSAIRSIQRRGRTGRHMP-GRVIILMAKGTRD
2p6rA4          VVEDAFRRGNIKVVVATPTLAAGVNLPARRVIVRSLKRIKVSEYKQMAGRAGRPGMRGEAIIIVGKRDR-
1pdoA           ----------------------------------------------------------------------
2g2jA1          SIIQRFRDGKEKVLITTNVCARGIDVKQVTIVVNFDLPPDYETYLHRIGRTKG-----LAFNMIEVDELP
1rybA           FLLQKFSSEERVQI--DTALEQGVDAVRT-LVLKGERFNLVQ----------------------------
1jr6A           ------PTNGDVVVVATDALMTGF-TGDFDSVIDCNTSDKPQDAVSRTQRRGRTGRGKPGI---------
1c4oA2          ALIRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADKEERSLIQTIGRAARNARGEVWLYADRVSEAM
1oywA3          DVQEKFQRDDLQIVVATVAFGXGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAXLFYDPADXA
1t5iA           SRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVDENDAK
1qhh.1          SFERDYPNAKVILLEQNYRSTKRILQAANEVIEHNVNRKPKRIWTE------------------------
1kyqA2          ----------------------------------------------------------------------
1gm5A4          RVMLEFAEGRYDILVSTTVIEVGIDVPRANVMVIENPERFGLAQLHLRGRVGRGGQEAYCFLVVGDVGEE
2p6rA3          ----------------------------------------------------------------------
2eyqA5          RVMNDFHHQRFNVLVCTTIIETGIDIPTANTIIIERADHFGLAQLHQLGRVGRSHHQAYAWLLTPHPK--
1w36B2          E--------AQEMLWLLQAVMTPERENTLRSALATSMMGLNALDIETLNNDEHAWDVVVEEFDGYRQIWR
1z3iX2          ----------------------------------------------------------------------
1a1vA2          TSGDVVVVATDAL-FTGDFDSVIDCNTXVTQTVDFSLDPTFTIETTTLPQDAVSGKPGIYRFVAPGERPS
1z3iX1          KIVERFNNPSFIFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSTGT
1rifA           ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1m6nA4          IIEEAGQKGAV--TIATNMAGRGTDIKGGLAVVGTERHESRRIDNQLRGRSGRQGDPGITQFYLSMEDEL
1wp9A1          ----------------------------------------------------------------------
1nktA4          IIAVAGRRGGVTVATNMAGRGTDIVLGGVDFLTDQRLRERGLDPVETPEEYEAAWHSELPGLYVLGTERH
1gkuB2          GDYEKFVEGEIDHLIGTAHRGLDLPER-IRFAVFVGCPSFRVTIEDIDSLSPQLYRNVDEIERLLPAVER
1oywA2          ----------------------------------------------------------------------
1b6rA1          --------------------NPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSR
1yksA1          ----------------------------------------------------------------------
1z5zA1          DIISKFQNNPSVIVLSVKAGGFGINLTSANRVIHFDRPAVENVIVHKLISVGT-----------------
1c7sA1          V---AYRLPVPGARVAGGKLEANIALPGLGIEYSTDGKQWQRYDAKAKPRYSRAEK--------------
1iibA           ----------------------------------------------------------------------
1c4oA1          PLRFEEFLERVSQVVFVSATPGPFELAHSGRVVEQIIR--------------------------------
2eyqA2          -RLDEASDRGRYLMIGA--AEHGFVDTVRNLALICE----SDLLGERVARRRQDSRRTI-----------
2nwuA1          KSLLKFHRLRNERILDSARKYLXKGIEGNTIAFXIHYQNPKEIVDWLAPKTAH-----------------
2fwrA2          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1ng5A           ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1g8eA           ----------------------------------------------------------------------
2bhrA2          SEYIKTRTNDWDFVVTTDISEMGANF-KAERVIDPRAGPMPVTHSSAAQRRGRVGRN-------------
2hv2A2          IKDLNDLXPTPAASVKI-----------------------------------------------------
1zb6A1          QVNLYFSELSAQTLEAESVLALGLHVPN-----ELGLKFCKRSFSVYPTLNWETGK--------------
1w36B1          ----------------------------------------------------------------------
2eyqA3          QILAEVAEGKIDILIGT-----------------------------------------------------
1gm5A3          KIKSGLRNGQIDVVIGT-----------------------------------------------------


                         .         .         +         .         .         .         .:490
query           QWRRIERFTNNRIDASVIEGFEPRRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1pjrA1          ----------------------------------------------------------------------
1fuuA           ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
1wzuA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1wp9A2          EAYYSSR---------------------------------------------------------------
2p6rA4          -EIAVKRYIFGEPE--------------------------------------------------------
1pdoA           ----------------------------------------------------------------------
2g2jA1          SLMKIQDHFNSSIKQLNAE---------------------------------------------------
1rybA           ----------------------------------------------------------------------
1jr6A           ----------------------------------------------------------------------
1c4oA2          QRAIEETNRRRALQEAYNHGITPE----------------------------------------------
1oywA3          WLRRCLEEKP------------------------------------------------------------
1t5iA           ILNDVQDRFEVNI---------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
1kyqA2          ----------------------------------------------------------------------
1gm5A4          AMERLRFFTLN------TDGFKIAE---------------------------------------------
2p6rA3          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1w36B2          KRGVMPMLRALMSA--------------------------------------------------------
1z3iX2          ----------------------------------------------------------------------
1a1vA2          GMFDSSVLCECYDAGXAWYELTPA----------------------------------------------
1z3iX1          IEEKILQRQAHKLSSCVVDE--------------------------------------------------
1rifA           ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1m6nA4          MRRFGAERTMAMLDRFGMDDSTP-----------------------------------------------
1wp9A1          ----------------------------------------------------------------------
1nktA4          ESRRIDNQLRGRSGRQGDPGES------------------------------------------------
1gkuB2          HIDEVREILKKVMGKERPQAKDVV----------------------------------------------
1oywA2          ----------------------------------------------------------------------
1b6rA1          LTATLEALIPLLPPE-------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1ng5A           ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1g8eA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
2hv2A2          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1w36B1          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1pjrA1          ----------------------------------------------------------------------
1fuuA           ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
1wzuA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1pdoA           ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1jr6A           ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
1kyqA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1w36B2          ----------------------------------------------------------------------
1z3iX2          ----------------------------------------------------------------------
1a1vA2          ----------------------------------------------------------------------
1z3iX1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1m6nA4          ----------------------------------------------------------------------
1wp9A1          ----------------------------------------------------------------------
1nktA4          ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
1oywA2          ----------------------------------------------------------------------
1b6rA1          ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1ng5A           ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1g8eA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
2hv2A2          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1w36B1          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1pjrA1          ----------------------------------------------------------------------
1fuuA           ----------------------------------------------------------------------
1hv8A1          ----------------------------------------------------------------------
1wzuA1          ----------------------------------------------------------------------
1gkuB1          ----------------------------------------------------------------------
1ig3A2          ----------------------------------------------------------------------
2fwrA1          ----------------------------------------------------------------------
1wp9A2          ----------------------------------------------------------------------
2p6rA4          ----------------------------------------------------------------------
1pdoA           ----------------------------------------------------------------------
2g2jA1          ----------------------------------------------------------------------
1rybA           ----------------------------------------------------------------------
1jr6A           ----------------------------------------------------------------------
1c4oA2          ----------------------------------------------------------------------
1oywA3          ----------------------------------------------------------------------
1t5iA           ----------------------------------------------------------------------
1qhh.1          ----------------------------------------------------------------------
1kyqA2          ----------------------------------------------------------------------
1gm5A4          ----------------------------------------------------------------------
2p6rA3          ----------------------------------------------------------------------
2eyqA5          ----------------------------------------------------------------------
1w36B2          ----------------------------------------------------------------------
1z3iX2          ----------------------------------------------------------------------
1a1vA2          ----------------------------------------------------------------------
1z3iX1          ----------------------------------------------------------------------
1rifA           ----------------------------------------------------------------------
1m6nA3          ----------------------------------------------------------------------
1a1vA1          ----------------------------------------------------------------------
1m6nA4          ----------------------------------------------------------------------
1wp9A1          ----------------------------------------------------------------------
1nktA4          ----------------------------------------------------------------------
1gkuB2          ----------------------------------------------------------------------
1oywA2          ----------------------------------------------------------------------
1b6rA1          ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1z5zA1          ----------------------------------------------------------------------
1c7sA1          ----------------------------------------------------------------------
1iibA           ----------------------------------------------------------------------
1c4oA1          ----------------------------------------------------------------------
2eyqA2          ----------------------------------------------------------------------
2nwuA1          ----------------------------------------------------------------------
2fwrA2          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1ng5A           ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------
1g8eA           ----------------------------------------------------------------------
2bhrA2          ----------------------------------------------------------------------
2hv2A2          ----------------------------------------------------------------------
1zb6A1          ----------------------------------------------------------------------
1w36B1          ----------------------------------------------------------------------
2eyqA3          ----------------------------------------------------------------------
1gm5A3          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxx
1pjrA1          ----
1fuuA           ----
1hv8A1          ----
1wzuA1          ----
1gkuB1          ----
1ig3A2          ----
2fwrA1          ----
1wp9A2          ----
2p6rA4          ----
1pdoA           ----
2g2jA1          ----
1rybA           ----
1jr6A           ----
1c4oA2          ----
1oywA3          ----
1t5iA           ----
1qhh.1          ----
1kyqA2          ----
1gm5A4          ----
2p6rA3          ----
2eyqA5          ----
1w36B2          ----
1z3iX2          ----
1a1vA2          ----
1z3iX1          ----
1rifA           ----
1m6nA3          ----
1a1vA1          ----
1m6nA4          ----
1wp9A1          ----
1nktA4          ----
1gkuB2          ----
1oywA2          ----
1b6rA1          ----
1yksA1          ----
1z5zA1          ----
1c7sA1          ----
1iibA           ----
1c4oA1          ----
2eyqA2          ----
2nwuA1          ----
2fwrA2          ----
2eyqA3          ----
1ng5A           ----
1w36D1          ----
1gm5A3          ----
1g8eA           ----
2bhrA2          ----
2hv2A2          ----
1zb6A1          ----
1w36B1          ----
2eyqA3          ----
1gm5A3          ----