[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF09446.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ddrA.bssp"
#ERROR : Can't open dsspfile "1df7A.bssp"
#ERROR : Can't open dsspfile "3dfrA.bssp"
#ERROR : Can't open dsspfile "1juvA.bssp"
#ERROR : Can't open dsspfile "1vdrA.bssp"
#ERROR : Can't open dsspfile "1j3iA.bssp"
#ERROR : Can't open dsspfile "1ai9A.bssp"
#ERROR : Can't open dsspfile "1cz3A.bssp"
#ERROR : Can't open dsspfile "2hxvA1.bssp"
#ERROR : Can't open dsspfile "1qzfA1.bssp"
#ERROR : Can't open dsspfile "1wspA1.bssp"
#ERROR : Can't open dsspfile "2aznA1.bssp"

## Summary of PDB Search
:166
    5e-62  42%  1ddrA  [c.71.1.1] DIHYDROFOLATE REDUCTASE
    8e-57  50%  1df7A  [c.71.1.1] DIHYDROFOLATE REDUCTASE
    1e-56  29%  3dfrA  [c.71.1.1] DIHYDROFOLATE REDUCTASE
    5e-44  28%  1juvA  [c.71.1.1] DIHYDROFOLATE REDUCTASE
    1e-36  31%  1vdrA  [c.71.1.1] DIHYDROFOLATE REDUCTASE
    3e-31  25%  1j3iA  [c.71.1.1] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    2e-30  33%  1ai9A  [c.71.1.1] DIHYDROFOLATE REDUCTASE
    3e-30  28%  1cz3A  [c.71.1.1] DIHYDROFOLATE REDUCTASE
    2e-26  16%  2hxvA1 [c.71.1.2] DIAMINOHYDROXYPHOSPHORIBOSYLAMINOPYRIMIDINE A:148
    5e-22  34%  1qzfA1 [c.71.1.1] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    2e-15  11%  1wspA1 [d.15.1.8] AXIN 1 PROTEIN A:750 -- 832
    2e-13  21%  2aznA1 [c.71.1.2] PUTATIVE 5-AMINO-6-(5-PHOSPHORIBOSYLAMINO)URACIL
:166

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTLLTLIVARARNGVIGRNNTLPWRLPEDLQHFKRTTMGAPIIMGRKTWDSIGRPLPGRRNIVVTRNRDL
1ddrA           --MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNIILSSQPGT
1df7A           --MVGLIWAQATSGVIGRGGDIPWRLPEDQAHFREITMGHTIVMGRRTWDSLPRPLPGRRNVVLSRQADF
3dfrA           -----FLWAQNRNGLIGKDGHLPWHLPDDLHYFRAQTVGKIMVVGRRTYESFPRPLPERTNVVLTHQEDY
1juvA           ---PTKTVDGFNELAFGLGDGLPWRVKKDLQNFKARTEGTIMIMGAKTFQSLPTLLPGRSHIVVCDLVTK
1vdrA           ---LVSVAALAENRVIGRDGELPWSIPADKKQYRSRIADDPVVLGRTTFESMRDDLPGSAQIVMSRSERS
1j3iA           EGKKNEVFNNYTFRGLGNKGVLPWKCNLDMKYFCAVTTYVVVVMGRTSWESIFKPLSNRINVILSRTLKD
1ai9A           -NVAIIVAALKPALGIGYKGKMPWRLRKEIRYFKDVTTRTAVIMGRKTWESIFRPLPDRLNIILSRSYEN
1cz3A           ---VIFVLAMDVSGKIA-SSVESWSSFEDRKNFRKITTEINVVMGRITFEEIGRPLPERLNVVLTRRPKT
2hxvA1          ---VALKYASTLDGKIDHRGDSKWITDKLRFKVHEXRNIYAVLVGAGTVLKDNPQLTCRVRVILDRKGVL
1qzfA1          -----VVAASVLSSGIGINGQLPWSISEDLKFFSKITNNKCLIMGRKTWDSIGRPLKNRIIVVISSSQDE
1wspA1          ----------------------------------------------------------------------
2aznA1          ---IISNVGXTLDGKLTINNDSRISCEEDLIRVHKIRANVDIXVGIGTVLKDDPRLTVHVRIVVDSKRVL


                         .         .         *         .         .         .         .:140
query           HIEGADVVGSIEDAQRLCIGAEQVFLIGGAQLYAEALPSADRLIVTEIDADVEGDAFFPAVDRTTWVETA
1ddrA           D-DRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVEGDTHFPDYEPDDWESVF
1df7A           MASGAEVVGSLEEA----LTSPETWVIGGGQVYALALPYATRCEVTEVDIGLAGDALAPVLD-ETWRGET
3dfrA           QAQGAVVVHDVAAVFAYAKQHQELVIAGGAQIFTAFKDDVDTLLVTRLAGSFEGDTKMIPLNWDDFTKVS
1juvA           DGDLAHFYITWEQYITYLDQNSKVSVIGGPALLYAALPYADEVVVSRIVKRHRVNSTVQLDDISKREMVE
1vdrA           SVDTAHRAASVEEAVDISLDAETAYVIGGAAIYALFQPHLDRMVLSRVPGEYEGDTYYPEWDAAEWELDA
1j3iA           FDEDVYIINKVEDLIVLKLNYYKCFIIGGSVVYQEFLKLIKKIYFTRINSTYECDVFFPEINENEYQIIS
1ai9A           EIIDDNIISSIESSLNLVSDVERVFIIGGAEIYNELISLVSHLLITEIEESIEMDTFLK-FPLESWTKQP
1cz3A           SNNPSFFNGSPADVVKFLKGYERVAVIGGKTVFTEFLKLVDELFVTVEPYVFKGIPFFDEFEGYFPLKLL
2hxvA1          SGKVFLSDCSVESILRNERDIDSVLVEGGSKVFSEFLDHADVVFGFYSTKIFKGLDVFSGYLSDVSVPPK
1qzfA1          ADPNVVVFRNLEDSIENLMSIENIFVCGGESIYRDALNFVDRIYLTRVALDIEFDTYFPEIPETFLPVYM
1wspA1          --DSIVVAYYFCGEP----IPYRTLVRGRAVTLGQTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAILPV
2aznA1          NKDAKTIIATTEDTKKIKIGIKSILLEGGGTLNWGXFKEVDEVSVYIAPKIFGGKEAPTYVDGEGFKTVD


                         +         .         .         .         .         *         .:210
query           RELHHSETNGFDYAFVTYERPAxxxx
1ddrA           SEFHDAAQNSHSYCFEILER------
1df7A           GEWRFSR-SGLRYRLYSYHR------
3dfrA           SRTVEDTNPALTHTYEVWQKKA----
1juvA           THWYKID-EVTTLTESVYK-------
1vdrA           ET------DHEGFTLQEWVR------
1j3iA           VS-DVYTSNNTTLDFIIYKK------
1ai9A           KSELQKKEGDFTYNYTLWTR------
1cz3A           EMRRLNERGTLFLKYS----------
2hxvA1          FKVVNVEFSDSEFLVEXR--------
1qzfA1          SQTF--CTKNISYDFMIFEK------
1wspA1          FEEKIGKVEKVD--------------
2aznA1          EELKNFYRLG-EGIVLEFKV------