[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF09485.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ng6A.bssp"

## Summary of PDB Search
:149
    3e-41  37%  1ng6A  [a.182.1.1] HYPOTHETICAL PROTEIN YQEY
:149

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSLKARINDDMKXXXXXXXXXXLGTVRLLLAAIKQREVDERIELDDAGITAVIDKMIKQRKDSISQFEQA
1ng6A           MSLLERLNQDMKLYMKNREKDKLTVVRMVKASLQNEAIKKKDSLTEDEELTVLSRELKQRKDSLQEFSNA


                         .         .         *         .         .         .         .:140
query           GRDDLVAKEKAELDVLVAYMPAQLSDAEVAAEVQKAVTESGAAGPQDMGKVMGLVKARLAGRADMTAVSA
1ng6A           NRLDLVDKVQKELDILEVYLPEQLSEEELRTIVNETIAEVGASSKADMGKVMGAIMPKVKGKADGSLINK


                         +         .         .         .         .         *         .:210
query           LVKAALAxx
1ng6A           LVSSQLS--