[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF09694.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vpdA2.bssp"
#ERROR : Can't open dsspfile "1wp4A1.bssp"
#ERROR : Can't open dsspfile "1vpdA1.bssp"
#ERROR : Can't open dsspfile "1i36A2.bssp"
#ERROR : Can't open dsspfile "1jaxA.bssp"
#ERROR : Can't open dsspfile "3cumA1.bssp"
#ERROR : Can't open dsspfile "1bg6A2.bssp"
#ERROR : Can't open dsspfile "2f1kA2.bssp"
#ERROR : Can't open dsspfile "1pgjA2.bssp"
#ERROR : Can't open dsspfile "2nacA1.bssp"
#ERROR : Can't open dsspfile "2i76A2.bssp"
#ERROR : Can't open dsspfile "1txgA2.bssp"
#ERROR : Can't open dsspfile "1gdhA1.bssp"
#ERROR : Can't open dsspfile "1ks9A2.bssp"
#ERROR : Can't open dsspfile "1psdA1.bssp"
#ERROR : Can't open dsspfile "2b0jA2.bssp"
#ERROR : Can't open dsspfile "1mfzA1.bssp"
#ERROR : Can't open dsspfile "1evyA2.bssp"
#ERROR : Can't open dsspfile "1dliA2.bssp"
#ERROR : Can't open dsspfile "2pv7A2.bssp"
#ERROR : Can't open dsspfile "1dxyA1.bssp"
#ERROR : Can't open dsspfile "1i36A1.bssp"
#ERROR : Can't open dsspfile "1omoA.bssp"
#ERROR : Can't open dsspfile "1lssA.bssp"
#ERROR : Can't open dsspfile "1f0yA2.bssp"
#ERROR : Can't open dsspfile "1tltA1.bssp"
#ERROR : Can't open dsspfile "1lnqA3.bssp"
#ERROR : Can't open dsspfile "1lsuA.bssp"
#ERROR : Can't open dsspfile "1b6rA2.bssp"
#ERROR : Can't open dsspfile "2nvwA1.bssp"
#ERROR : Can't open dsspfile "1eyrA.bssp"
#ERROR : Can't open dsspfile "1p9oA.bssp"
#ERROR : Can't open dsspfile "1mfzA3.bssp"
#ERROR : Can't open dsspfile "1eyzA2.bssp"
#ERROR : Can't open dsspfile "1xeaA1.bssp"
#ERROR : Can't open dsspfile "2g5cA2.bssp"
#ERROR : Can't open dsspfile "1e0dA1.bssp"
#ERROR : Can't open dsspfile "1hkuA1.bssp"
#ERROR : Can't open dsspfile "1jw9B.bssp"
#ERROR : Can't open dsspfile "1e3jA2.bssp"
#ERROR : Can't open dsspfile "1hdoA.bssp"
#ERROR : Can't open dsspfile "1acmA2.bssp"
#ERROR : Can't open dsspfile "1qmgA2.bssp"

## Summary of PDB Search
:289
    1e-43  41%  1vpdA2 [c.2.1.6] TARTRONATE SEMIALDEHYDE REDUCTASE A:3 -- 163
    9e-22  24%  1wp4A1 [a.100.1.1] 3-HYDROXYISOBUTYRATE DEHYDROGENASE A:158 -- 289
    2e-21  38%  1vpdA1 [a.100.1.1] TARTRONATE SEMIALDEHYDE REDUCTASE A:164 -- 296
    1e-20  25%  1i36A2 [c.2.1.6] CONSERVED HYPOTHETICAL PROTEIN MTH1747 A:1 -- 152
    2e-20  14%  1jaxA  [c.2.1.6] CONSERVED HYPOTHETICAL PROTEIN
    2e-20  31%  3cumA1 [a.100.1.1] PROBABLE 3-HYDROXYISOBUTYRATE DEHYDROGENASE
    3e-18  14%  1bg6A2 [c.2.1.6] N-(1-D-CARBOXYLETHYL)-L-NORVALINE DEHYDROGENASE
    6e-18  21%  2f1kA2 [c.2.1.6] PREPHENATE DEHYDROGENASE A:1 -- 165
    1e-17  24%  1pgjA2 [c.2.1.6] 6-PHOSPHOGLUCONATE DEHYDROGENASE A:1 -- 178
    5e-17  13%  2nacA1 [c.2.1.4] NAD-DEPENDENT FORMATE DEHYDROGENASE A:148 -- 335
    2e-16  16%  2i76A2 [c.2.1.6] HYPOTHETICAL PROTEIN A:2 -- 154
    2e-16  15%  1txgA2 [c.2.1.6] GLYCEROL-3-PHOSPHATE DEHYDROGENASE [NAD(P)+] A:1
    5e-15  14%  1gdhA1 [c.2.1.4] D-GLYCERATE DEHYDROGENASE A:101 -- 291
    1e-14  11%  1ks9A2 [c.2.1.6] 2-DEHYDROPANTOATE 2-REDUCTASE A:1 -- 167
    3e-14  15%  1psdA1 [c.2.1.4] D-3-PHOSPHOGLYCERATE DEHYDROGENASE A:108 -- 295
    7e-14  12%  2b0jA2 [c.2.1.6] 5,10-METHENYLTETRAHYDROMETHANOPTERIN HYDROGENASE
    4e-13  16%  1mfzA1 [a.100.1.4] GDP-MANNOSE 6-DEHYDROGENASE A:203 -- 300
    6e-13  11%  1evyA2 [c.2.1.6] GLYCEROL-3-PHOSPHATE DEHYDROGENASE A:9 -- 197
    8e-13  14%  1dliA2 [c.2.1.6] UDP-GLUCOSE DEHYDROGENASE A:1 -- 196
    3e-12  11%  2pv7A2 [c.2.1.6] T-PROTEIN [INCLUDES: CHORISMATE MUTASE (EC A:92 --
    2e-11  15%  1dxyA1 [c.2.1.4] D-2-HYDROXYISOCAPROATE DEHYDROGENASE A:101 -- 299
    2e-11  11%  1i36A1 [a.100.1.8] CONSERVED HYPOTHETICAL PROTEIN MTH1747 A:153 --
    4e-11  14%  1omoA  [c.2.1.13] ALANINE DEHYDROGENASE
    7e-11  10%  1lssA  [c.2.1.9] TRK SYSTEM POTASSIUM UPTAKE PROTEIN TRKA HOMOLOG
    3e-10  14%  1f0yA2 [c.2.1.6] L-3-HYDROXYACYL-COA DEHYDROGENASE A:12 -- 203
    7e-10  12%  1tltA1 [c.2.1.3] PUTATIVE OXIDOREDUCTASE (VIRULENCE FACTOR MVIM A:5
    4e-09   8%  1lnqA3 [c.2.1.9] POTASSIUM CHANNEL RELATED PROTEIN A:116 -- 244
    2e-08  18%  1lsuA  [c.2.1.9] CONSERVED HYPOTHETICAL PROTEIN YUAA
    9e-07  21%  1b6rA2 [c.30.1.1] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    8e-06   9%  2nvwA1 [c.2.1.3] GALACTOSE/LACTOSE METABOLISM REGULATORY PROTEIN
    9e-06  33%  1eyrA  [c.68.1.13] CMP-N-ACETYLNEURAMINIC ACID SYNTHETASE
    2e-05  18%  1p9oA  [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE
    4e-05  19%  1mfzA3 [c.26.3.1] GDP-MANNOSE 6-DEHYDROGENASE A:301 -- 436
    6e-05  16%  1eyzA2 [c.30.1.1] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2 A:2
    9e-05  13%  1xeaA1 [c.2.1.3] OXIDOREDUCTASE, GFO/IDH/MOCA FAMILY A:2 -- 122
    1e-04  24%  2g5cA2 [c.2.1.6] PREPHENATE DEHYDROGENASE A:30 -- 200
    1e-04  18%  1e0dA1 [c.5.1.1] UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
    1e-04  17%  1hkuA1 [c.2.1.4] C-TERMINAL BINDING PROTEIN 3 A:115 -- 307
    2e-04  17%  1jw9B  [c.111.1.1] MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
    2e-04  27%  1e3jA2 [c.2.1.1] NADP(H)-DEPENDENT KETOSE REDUCTASE A:143 -- 312
    3e-04  17%  1hdoA  [c.2.1.2] BILIVERDIN IX BETA REDUCTASE
    7e-04  12%  1acmA2 [c.78.1.1] ASPARTATE CARBAMOYLTRANSFERASE, CATALYTIC CHAIN
    8e-04  12%  1qmgA2 [c.2.1.6] ACETOHYDROXY-ACID ISOMEROREDUCTASE A:82 -- 307
:289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTTVAFIGLGAMGAPMVGHLIRAGHTVRAFVRRPEAADAARQLGAEPFFTPAEAAQGAAVVFTNVTSSED
1vpdA2          ---VGFIGLGIXGKPXSKNLLKAGYSLVVSDRNPEAIADVIAAGAETASTAKAIAEQCDVIITXLPNSPH
1wp4A1          ----------------------------------------------------------------------
1vpdA1          ----------------------------------------------------------------------
1i36A2          ---VGFIGFGEVAQTLASRLRSRGVEVVTSLEGRSPSTIERARTVGVTETSEEDVYSCPVVISAVTPG--
1jaxA           -------GTGNLGKGLALRLATLGHEIVVGSRREEKAEAIAGDASITGMKNEDAAEACDIAVLTIPWKNI
3cumA1          ----------------------------------------------------------------------
1bg6A2          --TYAVLGLGNGGHAFAAYLALKGQSVLAWDIDAQRIKEIQDRGAIIAEGPGLAGTAHPDLLTSDIGLAV
2f1kA2          ---IGVVGLGLIGASLAGDLRRRGHYLIGVSRQQSTCEKAVERQLVDEAGQDLSLLQTAKIIFLCTPIQL
1pgjA2          ---VGVVGLGVMGANLALNIAEKGFKVAVFNRTYSKSEEFMKKAFETMEAFAASLKKPRKALILVQAGAA
2nacA1          --HVGTVAAGRIGLAVLRRLAPFDVHLHYTDRHRLPESVEKELNLTWHATREDMYPVCDVVTLNCPLHPE
2i76A2          ---LNFVGTGTLTRFFLECLKIGYILSRS-------IDRARNLAEVYGGKAATLEKHPEVVFVIVPDRYI
1txgA2          --IVSILGAGAMGSALSVPLVDNGNEVRIWGTEFDTEILKSISAGRWPEQLEKCLENAEVVLLGVSTDGV
1gdhA1          --TLGIYGFGSIGQALAKRAQGFDMDIDYFDTHRASSSDEASYQATFHDSLDSLLSVSQFFSLNAPSTPE
1ks9A2          ---ITVLGCGALGQLWLTALCKQGHEVQGWLRVPQPYCSVNLVETDGSIFNESLTANDPDFLATLLVTLK
1psdA1          --KLGIIGYGHIGTQLGILAESLGMYVYFYDIENKLPLGN----ATQVQHLSDLLNMSDVVSLHVPENPS
2b0jA2          ----------------------------------IHLVHPEDVGLKVTSDDREAVEGADIVITWLPKGNK
1mfzA1          ----------------------------------------------------------------------
1evyA2          LNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYN
1dliA2          ---IAVAGSGYVGLSL-GVLLSLQNEVTIVDILPSKVDKINNLSIKATLDSKAAYKEAELVIIATPTNYN
2pv7A2          -KIVIVGGYGKLGGLFARYLRASGYPISILDREDWAVAESILANADVVIVSVPINLTLET----------
1dxyA1          --TVGVMGTGHIGQVAIKLFKGFGAKVIAYDPYPMKGDHP----DFDYVSLEDLFKQSDVIDLHVPGIEQ
1i36A1          ----------------------------------------------------------------------
1omoA           --VFGFIGCGTQAYFQLEALRRVFDIGEVKAVREKAAKKFVSYCEDRGISASEEASRCDVLVTTTPSRKP
1lssA           ---IIIAGIGRVGYTLAKSLSEKGHDIVLIDIDKDICKKASAEIDALVINGDCTKIKTLEDAGIEDADMY
1f0yA2          VKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDEFVEKT
1tltA1          ---IGVVGLGGIAQKAWLPVLAAASDWTLQGAWSPTRAKALPICESWRIPYADAASCDAVFVHSSTASHF
1lnqA3          --HVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGANFVHGDPTRVSDLEKANVRGARAVIVD
1lsuA           --QFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVILLSLGIRNFEYVIVAIGANIQ
1b6rA2          MKQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITA----------------------
2nvwA1          PIRVGFVGLTSGKSWVAKTHFLAIQQLSSQFPTLKSSLQTIEQLQLKHATGFDAQYKDIDMIVVSVKVPE
1eyrA           ------------GISLLGHTINAAISSKCFDRGGLIAEEAKNFGVEVVLRPAELASDTA------SSISG
1p9oA           VRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFPPQTWLS--------------------
1mfzA3          --KVGLLGLSFKAGELAEXLIGKGYELRIFDRNVEYARVHGANKEYIESDLDEVVASSDVLVLGNGDEL-
1eyzA2          --RVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSH-VINMLDGDALRRVVELEKPHYIV
1xeaA1          ---IAXIGLGDIAQKAYLPVLAQWPLVLCTRNPKVLGTLATRYRVSATCTDYRDVLQYGVDAVXIHAATD
2g5cA2          --NVLIVGVGFXGGSFAKSLRRSGGKIYGYDINPESISKAVDLGIEGTTSIAKVEDFSPDF---------
1e0dA1          --NVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTPPGLDKLVERHTGSLNDEWLMAADLIVASPGIALA
1hkuA1          --TLGIIGLGRVGQAVALRAKAFGFNVLFYDPYL-SDGIERALGLQRVSTLQDLLFHSDCVTLHCGLNEH
1jw9B           --RVLIVGLGGLGCAASQYLASAGNLTLLDFDTVSLSNLQRQTLHSDATVGQPKVESARDALTRINPHIA
1e3jA2          --TVLVIGAGPIGLVSVLAAKAYGAFVVCTARSPRRLEVAKNCGADVTLVVDP-----------------
1hdoA           VKKIAIFGTGQTGLTTLAQAVQAGYEVTVLVRDSSRLPSEGPRPAH-------------VVVGDVLQAAD
1acmA2          --HVAMVGDLKYGR-TVHSLTQALAKFDGNRFYEYILDMLDEKGIAWHSSIEEVMAEVDILYMTRVQKAN
1qmgA2          --QIGVIGWGSQAPAQAQNLKDSLTEAKSDVVVKIGLRKGSSEENGTLGDMWETISGSDLVLL-LISDSA


                         .         .         *         .         .         .         .:140
query           VREVLLGRNGVVEGAAPGTICVDHSTISPIVTREIAQALAACGIEALDCPVSGGTVGAQAATLTIMVGGK
1vpdA2          VKEVALGENGIIEGAKPGTVLIDXSSIAPLASREISDALKAKGVEXLDAPVSGGEPKAIDGTLSVXVGGD
1wp4A1          ----------------------------------------------------------------------
1vpdA1          ----------------------------------------------------------------------
1i36A2          ---VALGAARRAGRHVRGIY-VDINNISPETVRMASSLIEKGGF--VDAAIMGSVRRKGADIRIIASGRD
1jaxA           LREKIVVSPLVPVSRGAKGFTYSSERSAAEIVAEVLESEKVVSALHTIPAARFANLDEKFDWDVPVCGDD
3cumA1          ----------------------------------------------------------------------
1bg6A2          IHHASIAANIASYISEGQLIILNPGATGGALEFRKILRENGAPEVTIGETSSMLFTCRSERPGQVTVNAI
2f1kA2          ILPTL---EKLIPHLSPTAIVTDVASVKTAIAEPASQLWSGIGGHPXAGTAAQGIDGAEENLLTPTEYTD
1pgjA2          TDSTI---EQLKKVFEKGDILVDTGNAHFKDQGRRAQQLEAAGLRFLGMGISGGEEGARKG-PAFFPGGT
2nacA1          TEHMINDE--TLKLFKRGAYIVNTARGKLCDRDAVARALESGRLAGYAGDVWFPQPAPKDHPWRTM----
2i76A2          KTVAN-------HLNLGDAVLVHCSGFLSSEIFK-----KSGRASIHPNFSFLEKALEXKDQIVFGLEGD
1txgA2          LPVMSYLKDQYIVLISKGLIDFDNSVLTVPEAVWRLKHDLRERTVAITGPAIAREVAKRMPTTVVFSSPS
1gdhA1          TRYFFNKA--TIKSLPQGAIVVNTARGDLVDNELVVAALEAGRLAYAGFDVFAGYYDLPNTFLFPHIGS-
1ks9A2          AWQVSDAVKSLASTLPVTTPILLIHNGMGTIEELQNIQQPLLMGTTTHAARRDGNVIIHVANGITHIGPA
1psdA1          TKNMMGAK--EISLMKPGSLLINASRGTVVDIPALCDALASKHLAGAAIDVFPTEPATNSDPFTSPLCEF
2b0jA2          QPDII---KKFADAIPEGAIVTHACTIPTTKFAKIFKDLGREDLNITSYHPGCVPEMK-GQVYIAEGYAS
1mfzA1          ----------------------------------------------------------------------
1evyA2          GAEIKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIPSPLLSVLAGPSFAIEVATGVFTCVSIASAD
1dliA2          SRINYFDTQHVETVIKSHATLIIKSTIPIGFITEMRQKFQTDRIIFSPEFLRESKALYDNLYPSRIIVSC
2pv7A2          -------IERLKPYLTENXLLADLTSVKREPLAKXLEVHTGAVLGLHPXFGADIASXAK-QVVVRCDGRF
1dxyA1          NTHI--INEAAFNLMKPGAIVINTARPNLIDTQAMLSNLKSGKLAGVGIDTYEYETEDLLNLAKHGSFK-
1i36A1          ----------------------------------------------------------------------
1omoA           VVKAEWVEEGTH---------INAIGADGPGKQELDVEILKKAKIVVDDLEQAKHGGEINVAVSKGVIGV
1lssA           IAVT-GKEEVNLMSSLLAKSYGINKTIARISEIEYKDVFERLGVDVVVSPELIAANYIEKLIE-------
1f0yA2          LSTINELFKRLDKFAAEHTIFASNTSSLQITS---IANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTS
1tltA1          DVVSTLLNAG------VHVCVDKPLAENLRDAERLVELAARKKLTLMVGFNRRFFVGCARHFIECVQNQT
1lnqA3          LESDSETIHCILGIRKIDESVRIIAEAERYENIEQLRMAGADQVISPFVISGRL----------------
1lsuA           ASTLT---TLLLKELDIPNIWVKAQ------NYYHHKVLEKIGADRIIHPEKDMGVKIAQSLS-------
1b6rA2          ----------------------------------------------------------------------
2nvwA1          HYEKNILEHSSQNLNLRYLYVEWALAASVQQAEELYSISQQRANLQTIICLQGRYNSVVGNILRIYESIA
1eyrA           VIHAL-----ETIGSNSGTVTLLQPT-SPLRTGAIREAFS------------------------------
1p9oA           ----------------------------------------------------------------------
1mfzA3          ----------------------------------------------------------------------
1eyzA2          PEIEAIATDMLIQLEEEGLNVVP-----------------------------------------------
1xeaA1          VHSTLAAF---FLHLGIPTFVDKPLAASAQECENLYELAEKHHQ--------------------------
2g5cA2          ----------------------------------------------------------------------
1e0dA1          HPSLS-----------------------------------------------------------------
1hkuA1          NHHLIMRQGAFLVNTARGGLVDEKALAQALKEGRIRGA--------------------------------
1jw9B           ITPV----NALLDDAELAALIAEHDLVNVAVRNQLNAGCFAAKV-----PVSGAAIRMEGQITVFTYQDG
1e3jA2          ----------------------------------------------------------------------
1hdoA           VDKTVAGQDAVIVLL---GTRNDLSPTTVMSARNIVAAMKAHGVDKV-VACTSAFLLWDPTKVPPRLQAV
1acmA2          VKAQFVLRASDLHNAKANMKVLHPLPRVDEIATDVDKTPHAWYFQGNGIFA-------------------
1qmgA2          QADNY---EKVFSHMKPNSILGLSHGFLLGHLQSLGQDFPKNISVIAVCPKGMGPSVRRLAGINSSFAVH


                         +         .         .         .         .         *         .:210
query           AEVLEKVRPLLEQIGKTITHIGDSGAGQVAKLCNQIAQVVNIEGIAEAMRFAGAQGVDTAKVFQAMSTGM
1vpdA2          KAIFDKYYDLXKAXAGSVVHTG------------------------------------------------
1wp4A1          ------------------------GAGHAVKAINNALLAVNLWAAGEGLLALVKQGVSAEKALEVINASS
1vpdA1          ----------------------DIGAGNVTKLANQVIVALNIAAXSEALTLATKAGVNPDLVYQAIRGGL
1i36A2          AEEFMKLNRY----GLNIEVRGR-----------------------------------------------
1jaxA           DESKKVVMSLISEIDGLR-PLDAGPLSNSRLVESLTPLILNI-MRFNGMGELGI----------------
3cumA1          -----------------------DGAGQVAKVCNNQLLAVLXIGTAEAXALGVANGLEAKVLAEIXRRSS
1bg6A2          KGAMDFACLPAAKAGWALEQIGSVLPQYVA----------------------------------------
2f1kA2          PEQLAXLRSVLEPLGVKIYL--------------------------------------------------
1pgjA2          LSVWEEIRPIVEAAAAKAPCVTMNGSG-------------------------------------------
2nacA1          ----------------------------------------------------------------------
2i76A2          ERGLPIVKKIAEEISGKYFVIPS-----------------------------------------------
1txgA2          ESSANKMKEIFETEYFGVEV--------------------------------------------------
1gdhA1          ----------------------------------------------------------------------
1ks9A2          RQQDGDYSYLADILQTVLPDVA------------------------------------------------
1psdA1          DNVL------------------------------------------------------------------
2b0jA2          EEAVNKLYEIGKIARGKAFKM-------------------------------------------------
1mfzA1          ------------------------EVAEXIKYTCNVWHAAKVTFANEIGNIAKAVGVDGREVXDVICQD-
1evyA2          INVARRLQRIMSTGDRSFVC--------------------------------------------------
1dliA2          NDSPKVKADAEK----------------------------------------------------------
2pv7A2          PERYEWLLEQIQIWGAKIYQ--------------------------------------------------
1dxyA1          ----DPLWDELLGMPNVVPHIA------------------------------------------------
1i36A1          ------------------------GDASAIKMLRSSYTKGVSALLWETLTAAHRLGLE-EDVLEMLEYTE
1omoA           EDVHATIGEVI-----AGLKDGRESDEEITIFDSTGLAIQDVAVAKVVYENALSKNVGS-----------
1lssA           ----------------------------------------------------------------------
1f0yA2          QKTFESLVDFSKALGKHPVSCKDT----------------------------------------------
1tltA1          VPQTAGEQA-------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
2nvwA1          DYHFLKFD--------------------------------------------------------------
1eyrA           ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1mfzA3          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1xeaA1          ----------------------------------------------------------------------
2g5cA2          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1hkuA1          ----------------------------------------------------------------------
1jw9B           EPCYRCLSRLFGEAGVMAPLIGVIGSLQAMEAIKMLAG--------------------------------
1e3jA2          ----------------------------------------------------------------------
1hdoA           TDDHIRMHKVLRESGLKYVAVPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTDEYDGHST-------
1acmA2          ----------------------------------------------------------------------
1qmgA2          QDVDGRATDVALGWSIAL----------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AGSRMLDMLGPKMVTRDFSAGIESRLHAKDFGLAADIATEIGLELPAMRATSAQLGELMDQGWGKDDTSS
1vpdA2          ----------------------------------------------------------------------
1wp4A1          GRSNATENLIPQRVLRAFPKTFALGLLVKDLGIAMGVLDGEKAPSPLLRLAREVYEMAKRELGPDADHVE
1vpdA1          AGSTVLDAKAPXVXDRNFKPGFRIDLHIKDLANALDTSHGVGAQLPLTAAVXEXXQALRADGHGNDDHSA
1i36A2          ----------------------------------------------------------------------
1jaxA           ----------------------------------------------------------------------
3cumA1          GGNWALEVYNPAPASRDYSGGFXAQLXAKDLGLAQEAAQASASSTPXGSLALSLYRLLLKQGYAERDFSV
1bg6A2          ----------------------------------------------------------------------
2f1kA2          ----------------------------------------------------------------------
1pgjA2          ----------------------------------------------------------------------
2nacA1          ----------------------------------------------------------------------
2i76A2          ----------------------------------------------------------------------
1txgA2          ----------------------------------------------------------------------
1gdhA1          ----------------------------------------------------------------------
1ks9A2          ----------------------------------------------------------------------
1psdA1          ----------------------------------------------------------------------
2b0jA2          ----------------------------------------------------------------------
1mfzA1          ------HKLNLSRYYXRPGFAFGGSCLPKDVRALTYRASQLDVEHPXLGS--------------------
1evyA2          ----------------------------------------------------------------------
1dliA2          ----------------------------------------------------------------------
2pv7A2          ----------------------------------------------------------------------
1dxyA1          ----------------------------------------------------------------------
1i36A1          GNDFRESAISRL-----KSSCIHARRRYEEMKE-VQDMLAEVIDPVMPTCIIRIFDKLKDARLQ------
1omoA           ----------------------------------------------------------------------
1lssA           ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1tltA1          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
2nvwA1          ----------------------------------------------------------------------
1eyrA           ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1mfzA3          ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1xeaA1          ----------------------------------------------------------------------
2g5cA2          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------
1hkuA1          ----------------------------------------------------------------------
1jw9B           ----------------------------------------------------------------------
1e3jA2          ----------------------------------------------------------------------
1hdoA           ----------------------------------------------------------------------
1acmA2          ----------------------------------------------------------------------
1qmgA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           LLKVLExxx
1vpdA2          ---------
1wp4A1          ALRLLE---
1vpdA1          LACYYE---
1i36A2          ---------
1jaxA           ---------
3cumA1          VQKLFD---
1bg6A2          ---------
2f1kA2          ---------
1pgjA2          ---------
2nacA1          ---------
2i76A2          ---------
1txgA2          ---------
1gdhA1          ---------
1ks9A2          ---------
1psdA1          ---------
2b0jA2          ---------
1mfzA1          ---------
1evyA2          ---------
1dliA2          ---------
2pv7A2          ---------
1dxyA1          ---------
1i36A1          ---------
1omoA           ---------
1lssA           ---------
1f0yA2          ---------
1tltA1          ---------
1lnqA3          ---------
1lsuA           ---------
1b6rA2          ---------
2nvwA1          ---------
1eyrA           ---------
1p9oA           ---------
1mfzA3          ---------
1eyzA2          ---------
1xeaA1          ---------
2g5cA2          ---------
1e0dA1          ---------
1hkuA1          ---------
1jw9B           ---------
1e3jA2          ---------
1hdoA           ---------
1acmA2          ---------
1qmgA2          ---------