[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for rmet0:ABF09846.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1h3nA3.bssp"
#ERROR : Can't open dsspfile "1f9dA.bssp"
#ERROR : Can't open dsspfile "1ffyA3.bssp"
#ERROR : Can't open dsspfile "1a8hA2.bssp"
#ERROR : Can't open dsspfile "1gaxA3.bssp"
#ERROR : Can't open dsspfile "1h3nA2.bssp"
#ERROR : Can't open dsspfile "1rqgA2.bssp"
#ERROR : Can't open dsspfile "1n1bA2.bssp"
#ERROR : Can't open dsspfile "1j1uA.bssp"
#ERROR : Can't open dsspfile "1ffyA2.bssp"
#ERROR : Can't open dsspfile "1ileA3.bssp"
#ERROR : Can't open dsspfile "1f4lA2.bssp"
#ERROR : Can't open dsspfile "1bt1A.bssp"
#ERROR : Can't open dsspfile "1h78A.bssp"
#ERROR : Can't open dsspfile "1d2rA.bssp"
#ERROR : Can't open dsspfile "1iq0A2.bssp"
#ERROR : Can't open dsspfile "1li5A2.bssp"
#ERROR : Can't open dsspfile "1qmyA.bssp"
#ERROR : Can't open dsspfile "1j5qA1.bssp"
#ERROR : Can't open dsspfile "1irxA2.bssp"
#ERROR : Can't open dsspfile "2p84A1.bssp"
#ERROR : Can't open dsspfile "1gaxA2.bssp"
#ERROR : Can't open dsspfile "1jfaA.bssp"
#ERROR : Can't open dsspfile "1c4kA1.bssp"
#ERROR : Can't open dsspfile "1ileA2.bssp"
#ERROR : Can't open dsspfile "1a1xA.bssp"
#ERROR : Can't open dsspfile "1ileA1.bssp"
#ERROR : Can't open dsspfile "1euqA2.bssp"
#ERROR : Can't open dsspfile "1h3nA1.bssp"
#ERROR : Can't open dsspfile "1rqgA1.bssp"
#ERROR : Can't open dsspfile "1f4lA1.bssp"
#ERROR : Can't open dsspfile "2a6tA1.bssp"
#ERROR : Can't open dsspfile "1bs2A2.bssp"
#ERROR : Can't open dsspfile "1fl7B.bssp"
#ERROR : Can't open dsspfile "1nzjA.bssp"
#ERROR : Can't open dsspfile "2a4hA1.bssp"
#ERROR : Can't open dsspfile "2bl7A1.bssp"
#ERROR : Can't open dsspfile "1a8hA1.bssp"
#ERROR : Can't open dsspfile "1g59A2.bssp"
#ERROR : Can't open dsspfile "1x6mA.bssp"
#ERROR : Can't open dsspfile "1b25A1.bssp"
#ERROR : Can't open dsspfile "1edzA2.bssp"
#ERROR : Can't open dsspfile "1ffyA1.bssp"
#ERROR : Can't open dsspfile "1gaxA5.bssp"
#ERROR : Can't open dsspfile "1pzdA1.bssp"
#ERROR : Can't open dsspfile "2fiyA1.bssp"
#ERROR : Can't open dsspfile "1h3nA3.bssp"
#ERROR : Can't open dsspfile "1ffyA3.bssp"
#ERROR : Can't open dsspfile "1a8hA2.bssp"
#ERROR : Can't open dsspfile "1gaxA3.bssp"
#ERROR : Can't open dsspfile "1f4lA2.bssp"
#ERROR : Can't open dsspfile "1iq0A2.bssp"
#ERROR : Can't open dsspfile "1li5A2.bssp"

## Summary of PDB Search
:873
    2e-53  48%  1h3nA3 [c.26.1.1] LEUCYL-TRNA SYNTHETASE A:1 -- 225 A:418 -- 686
    2e-50   8%  1f9dA  [a.102.1.2] ENDO-1,4-BETA-GLUCANASE F
    6e-50  22%  1ffyA3 [c.26.1.1] ISOLEUCYL-TRNA SYNTHETASE A:1 -- 200 A:395 -- 644
    2e-48  18%  1a8hA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 348
    5e-45  19%  1gaxA3 [c.26.1.1] VALYL-TRNA SYNTHETASE A:1 -- 189 A:343 -- 578
    7e-43  37%  1h3nA2 [b.51.1.1] LEUCYL-TRNA SYNTHETASE A:226 -- 417
    4e-40  19%  1rqgA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 138 A:174 -- 396
    7e-40   9%  1n1bA2 [a.128.1.3] (+)-BORNYL DIPHOSPHATE SYNTHASE A:271 -- 598
    8e-40  15%  1j1uA  [c.26.1.1] TYROSYL-TRNA SYNTHETASE
    7e-38  22%  1ffyA2 [b.51.1.1] ISOLEUCYL-TRNA SYNTHETASE A:201 -- 394
    2e-35  23%  1ileA3 [c.26.1.1] ISOLEUCYL-TRNA SYNTHETASE A:1 -- 197 A:387 -- 641
    2e-33  21%  1f4lA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:4 -- 140 A:176 -- 388
    2e-33  14%  1bt1A  [a.86.1.2] PROTEIN (CATECHOL OXIDASE)
    2e-32   6%  1h78A  [c.7.1.3] ANAEROBIC RIBONUCLEOTIDE-TRIPHOSPHATE REDUCTASE
    9e-32  12%  1d2rA  [c.26.1.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
    2e-31  16%  1iq0A2 [c.26.1.1] ARGINYL-TRNA SYNTHETASE A:97 -- 466
    1e-29  15%  1li5A2 [c.26.1.1] CYSTEINYL-TRNA SYNTHETASE A:1 -- 315
    2e-29  10%  1qmyA  [d.3.1.2] PROTEASE
    3e-29  12%  1j5qA1 [b.121.2.3] MAJOR CAPSID PROTEIN A:25 -- 221
    8e-29  14%  1irxA2 [c.26.1.1] LYSYL-TRNA SYNTHETASE A:3 -- 319
    1e-28  10%  2p84A1 [b.172.1.1] ORF041 A:3 -- 135
    1e-25  26%  1gaxA2 [b.51.1.1] VALYL-TRNA SYNTHETASE A:190 -- 342
    3e-25  10%  1jfaA  [a.128.1.5] TRICHODIENE SYNTHASE
    1e-24   6%  1c4kA1 [c.23.1.4] PROTEIN (ORNITHINE DECARBOXYLASE) A:1 -- 107
    6e-23  23%  1ileA2 [b.51.1.1] ISOLEUCYL-TRNA SYNTHETASE A:198 -- 386
    3e-22   9%  1a1xA  [b.63.1.1] HMTCP-1
    1e-18  17%  1ileA1 [a.27.1.1] ISOLEUCYL-TRNA SYNTHETASE A:642 -- 821
    1e-17   8%  1euqA2 [c.26.1.1] GLUTAMINYL-TRNA SYNTHETASE A:8 -- 338
    3e-17  28%  1h3nA1 [a.27.1.1] LEUCYL-TRNA SYNTHETASE A:687 -- 814
    3e-17  12%  1rqgA1 [a.27.1.1] METHIONYL-TRNA SYNTHETASE A:397 -- 606
    1e-16  12%  1f4lA1 [a.27.1.1] METHIONYL-TRNA SYNTHETASE A:389 -- 548
    4e-16  30%  2a6tA1 [a.242.1.1] SPAC19A8.12 A:1 -- 94
    9e-15  15%  1bs2A2 [c.26.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:136 -- 483
    1e-14  18%  1fl7B  [g.17.1.4] FOLLICLE STIMULATING PROTEIN BETA CHAIN
    2e-14  21%  1nzjA  [c.26.1.1] HYPOTHETICAL PROTEIN YADB
    4e-14   7%  2a4hA1 [c.47.1.23] SELENOPROTEIN SEP15 A:62 -- 178
    4e-14  15%  2bl7A1 [a.29.8.2] ENTEROCINE A IMMUNITY PROTEIN A:3 -- 82
    1e-13  16%  1a8hA1 [a.27.1.1] METHIONYL-TRNA SYNTHETASE A:349 -- 500
    8e-12  26%  1g59A2 [c.26.1.1] GLUTAMYL-TRNA SYNTHETASE A:1 -- 305
    1e-09   9%  1x6mA  [b.88.1.4] GLUTATHIONE-DEPENDENT FORMALDEHYDE-ACTIVATING
    5e-09  22%  1b25A1 [a.110.1.1] PROTEIN (FORMALDEHYDE FERREDOXIN OXIDOREDUCTASE)
    4e-08   6%  1edzA2 [c.58.1.2] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE A:3
    1e-07  22%  1ffyA1 [a.27.1.1] ISOLEUCYL-TRNA SYNTHETASE A:645 -- 917
    3e-07  26%  1gaxA5 [a.27.1.1] VALYL-TRNA SYNTHETASE A:579 -- 796
    4e-05  12%  1pzdA1 [b.1.10.3] COATOMER GAMMA SUBUNIT A:604 -- 762
    4e-04  15%  2fiyA1 [e.59.1.1] PROTEIN FDHE HOMOLOG A:19 -- 308
    7e-45  58%  1h3nA3 [c.26.1.1] LEUCYL-TRNA SYNTHETASE A:1 -- 225 A:418 -- 686(query 3->232)
    6e-13  25%  1ffyA3 [c.26.1.1] ISOLEUCYL-TRNA SYNTHETASE A:1 -- 200 A:395 -- 644(query 431->684)
    1e-11  14%  1a8hA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 348(query 434->686)
    6e-11  18%  1gaxA3 [c.26.1.1] VALYL-TRNA SYNTHETASE A:1 -- 189 A:343 -- 578(query 508->686)
    2e-14  13%  1f4lA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:4 -- 140 A:176 -- 388(query 487->692)
    4e-06   8%  1iq0A2 [c.26.1.1] ARGINYL-TRNA SYNTHETASE A:97 -- 466(query 486->683)
    1e-10  17%  1li5A2 [c.26.1.1] CYSTEINYL-TRNA SYNTHETASE A:1 -- 315(query 492->683)
:873

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQDKYLPSAVEQAAQQHWKAIDAYKVSEHAVGPDGKEKSKFYACSMLPYPSGKLHMGHVRNYTINDVMAR
1h3nA3          ----------------------------------------------------------------------
1f9dA           --------------NWYGFGARADGTSKPSYINTFQRGEQESTWETIPQPCW-DEHKFGGQYGFLDLFTK
1ffyA3          FPMRGGLPNKEPQIQEKWDAEDQYHKALEK----NKGNETFILHDGPPYANGNLHMGHALNKILKDFIVR
1a8hA2          -------------------------------------EKVFYVTTPIYYVNAEPHLGHAYTTVVADFLAR
1gaxA3          LPKAYDPKSVEPKWAEKWAKNPFVA-------NPKSGKPPFVIFMPPPNVTGSLHMGHALDNSLQDALIR
1h3nA2          ----------------------------------------------------------------------
1rqgA2          ---------------------------------------RYMVTSALPYANGPIHAGHLAGAYLPAIFVR
1n1bA2          ----ATHQQELKDLSRWWSRLCFPEKLPFVRDRLVESFFWAVGMFEHQHGYQRKMAATIIATVIDDIYDV
1j1uA           --------EFEMIKRNTSEIISEEELREV------LKKDEKSAYIG-FEPSGKIHLGHYLQIKKMIDLQN
1ffyA2          ----------------------------------------------------------------------
1ileA3          EVGEPNFPKLEEEVLAFWKREKIFQKSV----ENRKGGPRYTVYEGPPTANGLPHVGHAQARSYKDLFPR
1f4lA2          ---------------------------------------KILVTCALPYANGSIHLGHMLEHIQADVWVR
1bt1A           ----------------------------------------------------------------------
1h78A           ---------------------------------------------------AQSKTEKDVYDAFQAYEYE
1d2rA           -----------------------------------------------IQPSGVITIGNYIGALRQFVELQ
1iq0A2          --------------------------------PFPRRPGVVLVEHTSVNPNKELHVGHLRNIALGDAIAR
1li5A2          --------------NTLTRQKEEFK-------PIHAGEVGMYVCG--ITVYDLCHIGHGRTFVAFDVVAR
1qmyA           ------------------------------------------------------TLYNGEKKTFYSRPNN
1j5qA1          ----------------------------------------------------------------------
1irxA2          ----------------HWADYIADKIIRERGEK------EKYVVESGITPSGYVHVGNFRELFTAYIVGH
2p84A1          ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1jfaA           FLEITSAIAQMENWMVWVNDLMSFYKEFD-------DERDQISLVKNYVVSDEISLHEALEKLTQDTLHS
1c4kA1          --------------------------------------------------------SSLKIASTQEARQY
1ileA2          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
1euqA2          -------------------------------------KHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQ
1h3nA1          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
2a6tA1          ----------------------------------------------------------------------
1bs2A2          -----------------------------------------------PNIAKPFHAGHLRSTIIGGFLAN
1fl7B           ----------------------------------------------------------------------
1nzjA           -----------------------------------------YIGRFAPSPSGELHFGSLIAALGSYLQAR
2a4hA1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1g59A2          -----------------------------------------------PSPTGDPHVGTAYIALFNYAWAR
1x6mA           ----------------------------------------------------------------------
1b25A1          ------WDDLYKAADRVYSLIRAYWVREFNGKWDRKMDYPPKRWFTEGLKSGPHKGEHLDEKKYDELLSE
1edzA2          ------------------------------------LEEAIIQANGDDSVNGIMVYFNAQDQYLQQVVCK
1ffyA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
2fiyA1          ----------------------------------------------------------------------
1h3nA3          --EKYNPHAIEAKWQRFWEEKGFMKAKDLPGGRG-----KQYVLVMFPYPSGDLHMGHLKNYTMGDVLAR
1ffyA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           YLRMNGRNVLMPMGWDAFGMPAENAALNNGVAPAAWTYDNIAYMKKQMQSMGLAIDWSREVATCSPEYYR
1h3nA3          ----------------------------------------------------------------------
1f9dA           DTGTPAKQFKYTNAPDADARAVQATY-WADQWAKEQGKSVSTSVGKATKMGDYLRYSFFDKYIGQPSQAG
1ffyA3          YKTMQGFYAPYVPGWDTHGLPIEQALTKKGVDRKEFALEQIELQKKDFRRLGVRGDFNDPYITLKPEYEA
1a8hA2          WHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAFVDRVSGRFKRAWDLLG--IAYDDFIRTTEERHKK
1gaxA3          YKRMRGFEAVWLPGTDHAGIATQVVVERLLLKEGQWKEESGGTILKQLKRLGASADWSREAFTMDEKRSR
1h3nA2          ----------------------------------------------------------------------
1rqgA2          YLRLKGEDVVFICGTDEHGTPISFRALKEGRSPREIVDEFHEQIKITFQRAKISFDFFGR--TELPIHYK
1n1bA2          YGTLDELELFTDTRWDTESITRLPYYMQLCYWGFFCLQYLRKSVVDLVEAYFHEAKWYHSGYTSLDEYLN
1j1uA           A------------GFDIIILLADLHAYLNQKGELDEIRKIGDYNKKVFEAMGLKAKYVYGSEFQLDKDYT
1ffyA2          ----------------------------------------------------------------------
1ileA3          YKTMRGYYAPRRAGWDTHGLPVELEVEKKLGLKSESVFTYEKEWEAFTERIAYWVDLEDAYATLEPTYIE
1f4lA2          YQRMRGHEVNFICADDAHGTPIMLKAQQLGITPEQMIGEMSQEHQTDFAGFN--ISYDNYHSTHSEENRQ
1bt1A           ----------------------------------------------------------------------
1h78A           VNTLFSSNTPFVTITFGTGTDWTERMIQKAILKNRIKGLGRDGITPIFPKLVMFVEEGV--------NLY
1d2rA           ------------HEYNCYFCIVDQHAITVWQDP-HELRQNIRRLAALYLAVGIDPTQ----------ATL
1iq0A2          ILAYAGREVLVLNYIDDTGRQAAETLFALRHYGLTWDRLHQDPEYERLQPAIEEVLHALERGELREEVNR
1li5A2          YLRFLGYKLKYVRNITDIDDKIIKRANENGESFVAMVDRMIAEMHKDFDALNILRPDME---PRATHHIA
1qmyA           HDNAWLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWKHLLHTGIGTASRPSEAD
1j5qA1          ----------------------------------------------------------------------
1irxA2          ALRDKGYEVRHIHMWDDYDRFRKVPVPDPWGCHESYAEHFMRKFEEEVEKLGIEVDLLYASELKRGEYSE
2p84A1          -------------------IPKFREFDRERHRTDYQKGMSYAEQQDFDMGFT--IWFDHIEDLDLIEKDG
1gaxA2          ----------------------------------------------------------------------
1jfaA           SKQMVAVDPQVMDTIECFMHGYVTWHLCDRRYRLSEIY------------------------EKVKEEKT
1c4kA1          FDTDRVVVDAVGSDFTDVGAVIAMDYETDVIDAADATKFGIPVFAVTKDAQAISADELKK-IFHIIDLEF
1ileA2          ----------------------------------------------------------------------
1a1xA           ---------------EDVGAPPDHLWVEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLT----
1ileA1          ----------------------------------------------------------------------
1euqA2          DYKGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFHWSGNVRYSSDYFDQLHAYAIELINKGLAYVDELT
1h3nA1          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
2a6tA1          -----------------LNLPAEEQSLCFQIEQAHWFYDFIRAQNDQLPSLGLRVFSAKLFAHC-PLLWK
1bs2A2          LYEKLGWEVIRMNYLGDWGKQFGLVGFERYGNEEALVKDPIHHLFDVYVRINKDIEEEGDSIPLEQSTNG
1fl7B           ----------------------------------------------------------------------
1nzjA           -----ARQGRWLVRIE-------------DIDPPREVPGAAETILRQLEHYG--LHWDGDVLWQSQRHDA
2a4hA1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1g59A2          --RNGGRFI---VRIE-------------DTDRARYVPGAEERILAALKWLGLSYDEGPDVAAPTGPYRQ
1x6mA           ----------------------------------------------------------------------
1b25A1          YYRI--------RGWDERGIPKKETLKELDLD--------------------------------------
1edzA2          EKDVEGLNHVYYQNLY-HNVRYLDKENRLKS---------------------------------------
1ffyA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1pzdA1          ------------------------------------------------------------------KVAA
2fiyA1          ----------------------------------------------------------------------
1h3nA3          FRRMQGYEVLHPMGWDAFGLPAENAALKFGVHPKDWTYANIRQAKESLRLMGILYDWDREVTTCEPEYYR
1ffyA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           WNQWLFLKMLEKGIAYRKTGTVNWDPVDQTVLANEQVIDGRGWRSGAVVEKREIPMYYLRITDYAQELLG
1h3nA3          ----------------------------------------------------------------------
1f9dA           TGYDAAHYLLSWYYAWGGGIDSTWSWIIGSSHNHFGYQNP--------------FAAWVLSTDANFKPKS
1ffyA3          AQIRIFGEMADKGLIYKGKKPVYWSPSSESSLAEAEIEYPHDWRTKKPVIFRATPQWFASISKVRQDILD
1a8hA2          VVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEKELVEGLCPIHGRPVERRKEGNYFFRMEKYRPWLQE
1gaxA3          AVRYAFSRYYHEGLAYRAPRLVNWCPRCETTLSDLEV--ETCSRCGTPIEYAIFPQWWLRMRPLVLKGLR
1h3nA2          ----------------------------------------------------------------------
1rqgA2          LSQEFFLKAYENGHLVKKVTKQAYCEHDKMFLPD------RFAICGRPISFRDSAHYYIKMQDFAERLKR
1n1bA2          IAKISVASPAIISPTYFTFANASHDTAVIDSLYQYH--------------------DILCLAGIILRLPD
1j1uA           LNVYRLALKTTLKRARRSMELIAREDENPKVAE-----------------------VIYPIMQVNDIHYL
1ffyA2          ----------------------------------------------------------------------
1ileA3          SIWWSLKNLFDRGLLYRDHKVVPYCPRCGTPLSSHEVGYPHCWRCSTPLMYYATESWFIKNTLFKDELIR
1f4lA2          LSELIYSRLKENGFIKNRTISQLYDPEKGMFLP------DRFVVSGATPVMRDSEHFFFDLPSFSEMLQA
1bt1A           ----------------------------------------------------------------------
1h78A           KDDPNYDIKQLALECASKRMYPDIISAKNNKAITGSSVPVSPMGCRSFLSVWKDSTGNEILDGRNNLGVV
1d2rA           FIQSEVPAHAQAAWMLQCIVYIGELERMTQFYPPLMAADILLYNTDIVPVGEDQKQHIELTRDLAERFNK
1iq0A2          ILLAQMATMHALNARYDLLVWESDIVRAGLLQKA-----LALLEQSPHVFRPREGKYAGALVMDASPVIP
1li5A2          EIIELTEQLIAKGHAYVADNGDVMFDVPTDPTYGVLSRQKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGW
1qmyA           FHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPY-----------------------
1j5qA1          ----------------------------------------------------------------------
1irxA2          EIRLAFEKRDKIMEILNKYREIAKQPPLPENWWPAMVYCPEHRREAEIIEWDGGWKVKYKCPEGHEGWVD
2p84A1          TINRIVMMSTGLKDKNVKEIYESVRNLYGELYVVEWL------DGSFVLTEFYNGGYDHYIIDSSTEYEV
1gaxA2          ----------------------------------------------------------------------
1jfaA           EDAQKFCKFYEQAANVGAVSPSEWAYPPVAQLAN------------------------------------
1c4kA1          DATVNAREIETAVNNY------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1a1xA           -SQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGQELL--------------------------------
1ileA1          ----------------------------------------------------------------------
1euqA2          PEQIREYRGTLTQPGKNSPYRDRSVEENLALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKF
1h3nA1          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
2a6tA1          WHEEAFDDFLRY----------------------------------------------------------
1bs2A2          KAREYFKRMEDGDEEALK----------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1nzjA           YREA-LAWLHEQGLSYY-----------------------------------------------------
2a4hA1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1g59A2          SEQKYAEELLKRGWAYR-----------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1pzdA1          TRQEIFQEQLAAVPEFQGLGPLFKSSPEPVALTESET---------------------------------
2fiyA1          ----------------------------------------------------------------------
1h3nA3          WNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANEQVVGRCWRHEDTPVEKRELEQWYLRITAYAERLLK
1ffyA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DLEGLGWPERVKIMQQNWIGRSEGVRFAFPHEIKGADGKLINDGKLYVFTTRADTIMGVTFCAVAAEHPL
1h3nA3          ----------------------------------------------------------------------
1f9dA           SNGASDWAKSLDRQLYQWLQSAEGAIAGGAT-----------NSWNGRYEAVTSTFYGMGYVENPVYADP
1ffyA3          AIENTNFKVNWGKTRIYNMVRDRGEWVISR-----------------------QRVWGVPLPVFYAENGE
1a8hA2          YIQENPRPEGYRNEVLAMLAEPIGDLSISRPKSRVPWGIPLPWDENHVTYVWFDALLNYVS---ALDYPE
1gaxA3          RGDIAFVPERWKKVNMDWLENVKD----WNISRQLWWGHQIPAWYCEDCQAVNVPRPERYLEDPTSCEAC
1h3nA2          --------------------RSEGAEILFP--VEGKEVRIP------VFTTRPDTLFGATFLVLAPEHPL
1rqgA2          WIEKQWKPNVKNMVLSWIEEGLE--------------------ERAITRDLNWGIPVPLDEEDMKGKVLY
1n1bA2          DLGDVPKTIQCYMKETNASEEEAVEHVKF-----------------------------------------
1j1uA           GVDVAGMEQRKIHMLARELLPKKVVCIHNPVLTGLD-----GEGNFIAVDDSPEEIRAKIKKAYCPAGVV
1ffyA2          --------------------RSASIYVAFN--VKDDKGVVDADAKFIIWTTTPWTIPSNVAITVHPELKY
1ileA3          NNQEIHWVPPHIKEGRYG----------------------------------------------------
1f4lA2          WTSGALQEQVANKMQEWFESGLQQWDISRDAPYFGFEIPNAPGKYFYVW---------------------
1bt1A           ----------------------------------------------------------------------
1h78A           TLNLPIALDSYIGTQFNEQKFVELFNERM----------DLCFEALMCRISSLKGVKATVAPILYQEGAF
1d2rA           RYELFTIPEARIPKVGARIMSLVDPTKKMSKSDPNPK-------AYITLLDDAKTIEKKIKSAVTDSEGT
1iq0A2          GLEDPFFVLLRSNGTATYYAKDIAFQFWKMGI--------------------------------------
1li5A2          HIECSAMNCKQLGNFDIHGGGSDLMFPHHENEIAQSTCAHDGQYVNYWMHSGMVMVDREKMSKSLGNFFT
1qmyA           ----------------------------------------------------------------------
1j5qA1          ----------------------------------------------------------------------
1irxA2          IRSGNVKLRWRVDWPMRWSH--------------------------------------------------
2p84A1          LGNIYENPELLEDDN-------------------------------------------------------
1gaxA2          --------------------------------------EVEGGGFIEIATVRPETVFADQAIAVHPED--
1jfaA           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1ileA2          ---------------------------------------------LLIWTTTPWTLPGNVAAAVHPEYTY
1a1xA           ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
1euqA2          AEHHQTGN--------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
2a6tA1          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
2a4hA1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
2fiyA1          ----------------------------------------------------------------------
1h3nA3          DLEGLNWPEKVKAMQRAWIGRL------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ATHAAESNPALAAFIEECKHGSVMEADMATMEKKGMPTGLKVTHPLTGEQVDVWVGNYVLMTYGDGAVMG
1h3nA3          ----------------------------------------------------------------------
1f9dA           GSNTGMQVWSMQRVAELYYKTGDARAKKLLDKWAKWINGEIKFNADGTFQIPSTIDWEGQPDTWNPTQGY
1ffyA3          IIMTKETVNHVADLFAEHGSNIWFEREAKDLLPEGF------THPGSPNGTFTKETDIMDVWFDSGSSHR
1a8hA2          GEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPMYRHLNVGPDGRKMSKTLGNALLEKYGRDALLL
1gaxA3          GSPRLKRDEDVFDTWFSSALWPLSTLGWPEETEDLKAFYPGDVLVTGYDILFLWVSRMEVSFMGERPFKT
1h3nA2          TLELAAPEKEVLAYVEAAKRKTEIERQAEGREKTGVFLGAYALNPATGERIPIWTADYVLFGYGTGAIMA
1rqgA2          VWFEAPIGYISITIEHFKRIGKPNEWKKYWLNIDGQTR---VIHFIGKDNIPFHAIFWPAFLMAYGKYKD
1n1bA2          ----------------------------------------------------------------------
1j1uA           EGN---------PIMEIAKYFLE--------YPLTIKRPEKFGGDLTVNSYEELESLFKNKELHPMDLKN
1ffyA2          GQYNVNGEEALSDAVAEALDWDKASIKLEKEYTGKELEWVVAQHPFLDRESLVINGDHVTTDAGTGCVHT
1ileA3          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
1h78A           GVRLKPDDDIIELFKNGRSSVSLGYIGIHELNILVGRDIGREILTKMNAHLKQWTE----RTGFAFSLYS
1d2rA           IRYDKEAKPGISNLLNIYSTLSGQSIEELERQYEGK----------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1j5qA1          -------------------------------------TFFKVYRRYTNFAIESIQQTINGS-VGFGNKVS
1irxA2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1gaxA2          -------------------------------ERYRHLLGKRARIPLTEVWIPILADPAVEKDFGTGALKV
1jfaA           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1ileA2          AAFQVGDEALI---LEEGLGRKLLTQVLKTFPGKAL-EGLPYTPPYPQAGYFVVLADYVSQEDGTGIVHQ
1a1xA           ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
2a6tA1          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
2a4hA1          -----------------------------------------------------------------KAILE
2bl7A1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
2fiyA1          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VPAHDERDFAFALKYNLPIKQVIDVKGQAYSTDAWLEWYGDKEHGLCIHSGKYDGLGYXXXXXXXXXXXX
1h3nA3          ----------------------------------------------------------------------
1f9dA           TGNANLHVKVVNYGTDLGCASSLANTLTYYAAKSGDET--SRQNAQ------------------------
1ffyA3          GVLETRPELSFPADMYLEGSDQYR--GWFNSSITTSVATRGVS---------------------------
1a8hA2          REIPYGQDTPVSEE--------------------------------------------------------
1gaxA3          VLLHGLVLDEKGQKMSKSKGNVIDPLEERYGADALRFAL-------------------------------
1h3nA2          VPAHDQRDYEFARKFGLPIKKVIERPGEPLPEP--LE-RAYEEPGIMVNSGPFDGTESEEGKRKVIAWLE
1rqgA2          DIPANEYLTLEGKKFSTSRNWAIWVHEDVFPADYLRYYL-------------------------------
1n1bA2          ----------------------------------------------------------------------
1j1uA           AVAEELIKI-------------------------------------------------------------
1ffyA2          APGHGEDDYIVGQQYELPVISPIDDKGV-----------------FTEEGGQFEGMFYDKANKAVTDLLT
1ileA3          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
1h78A           TPAENLCYRFCKLDTEKYGSVKD--VTDKGWYTNSFHVSVEENITPFEKISREAPYHFIATGGHISYVEL
1d2rA           ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1j5qA1          TQISRNGDLITDIVVEFVLTK----------GGNGGTTYYPAEELLQDVELEIGGQRIDKHYNDWFRTYD
1irxA2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1gaxA2          TPAHDPLDYEIGERHGLKPVSVINLEG-------------------------------------------
1jfaA           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1ileA2          APAFGAEDLETARVYGLPLLKTVDEEG-------------------KLLVEPFKGLYFREANRAILRDLR
1a1xA           ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
2a6tA1          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
2a4hA1          VCTCKFRAYPQIQAFIQSGRPAKFPNLQIKYVDPVVKLL--DASGKVQETLSITKWNTDTVEEFFETHLA
2bl7A1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
2fiyA1          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXXXEKKVTWRLRDWGISRQRYWGTPIPLIHCDSCGVVPVPEKDLPVVLPEDLVPDGTGNPLAKDPRFL
1h3nA3          ----------GRLRDWLISRQRYWGTPIPMVHCEACGVVPVPEEELPVLLPDEDIRPKGKSPLEAHPEFY
1f9dA           ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1h3nA2          EKGLGKGRVTY-----------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1ffyA2          EKGALLKLDFIT----------------------------------------------------------
1ileA3          ----------KNLVDWALSRNRYWGTPLPIWVCQACGKEEAIGSFQELKARATKPLPEPFDPHRPYVDQV
1f4lA2          ----------------------------------------------------------------------
1bt1A           --------------------------PIQAPEISKCVVPPA-------DLPPGAVVDNCCPPVANIVDYK
1h78A           PDMKNNLKGLEAVWDYAAQHLDYFGVNMPVDKCFTMNTI-------------------------------
1d2rA           ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1j5qA1          ALFRMNRRMTDWVNNELVGAQKRFYVPLIFFFNQTPG-LALPLIALQYHEV--------KLYFTLASQVQ
1irxA2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1ileA2          GRGLLFKEESYL----------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
2a6tA1          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1fl7B           ---------TAWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYE--TVRVPGC---AHHADSLYTYPVAT
1nzjA           ----------------------------------------------------------------------
2a4hA1          KDGAGKNSYSV-----------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1x6mA           -------------RHRCRDCGVHMYGRIENRDHPFYGLDFVHTELSDEDGWSAPEFA-----------AF
1b25A1          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
2fiyA1          -----ALQVAWSHWLLGLEEGAVV-ETESRTLCPACGSPPM----------AGMIRQTGLRYLSCEWHYV
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------RDRGEWVISRQRVWGVPLPVFYAENGEIIMTKETVNHVADLFAEHGSNFEREAKDLLPEG
1a8hA2          -------------VERRKEGNYFFRMEKYRPWLQEY-IQENPDLIRPEGYRNEVLAMLAEPIGDLSISRP
1gaxA3          ----------------------------------------------------------------------
1f4lA2          ------------------------------------------------------------------RDAP
1iq0A2          -----------------------------------------------------------------DLLVW
1li5A2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           ECTCPSCGKPARRETDTMDTFIDSCWYYMRYTCPDAGTMVDARNDYWMPMDQYIGGIEHAILHLLYARFW
1h3nA3          ETTCPKCGGPAKRDTDTMDTFFDSSWYYLRYTDPHNDRLPFDPENAWMPVDQYIGGVEHAVLHLLYSRFF
1f9dA           ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
1ileA3          EL-ACACGGTMRRVPYVIDVWYDSGAMPFASLHY--PFEHEEVFRESFPADFIAEGIDQTRGWFNSLHQL
1f4lA2          ----------------------------------------------------------------------
1bt1A           LPAV--TTMKVRPAAHTMDKFAKAVELMKALPADDPRNCAYCNGGYDQVNFPDQEIQVHNPFHRWYLYFY
1h78A           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1j5qA1          GVNYNGSSAIAGAAQPTMSVWVDY----------------------------------------------
1irxA2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
2a6tA1          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1fl7B           QCHCGKC------DSDSTDCTVRGL--GPSY---------------------------------------
1nzjA           ----------------------------------------------------------------------
2a4hA1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1a8hA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1x6mA           VSSIIESGVDPSRMEAIRARLRELLEPYDALSPPLMDAI-------------------------------
1b25A1          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
2fiyA1          RIKCSHCEESKHLAYLSLEHGQPAEKAVLRETCPSCQGQFYLEFD-------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          FTHPGSPNGTFTKETDIMDVWFDSGSSHRGVLETRP--------ELSFPADMYLEGSDQYRGWFNSSITT
1a8hA2          KSRVPWGIPLPWDENHVTYVWFDALLNYVSAL----DYPEGEAYRTFWPHAWHLIGKDIL-------KPH
1gaxA3          -----------------VPRPERYLEDPTSCEACGSPRLKRDEDVFDTWFSSALWPLSTLGWPEETEDLK
1f4lA2          YFGFEIPNAPGKYFYVWLDAPIGYMGSFKNLCDKRGDSVSFDEYKDSTAELYHFIGKDIVYFHSLFWPAM
1iq0A2          ESDIVRAGLLQKALALLEPHVFRPREGKYAGALVMDASPVIPGLEDPFF---VLLRSNGTATYYAKDIAF
1li5A2          -QKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGWHIECSAMN-CKQLGNHFDIHGGGSDLMFPHHENEIAQ


                         .         .         .         *         .         .         .:630
query           TKVMRDMGLVKFDEPFTNLLTQGMVLNETFYREDASGKKTWYNPADVDVQTDERGRPAGATAKADGQPVV
1h3nA3          TKFLHDLGMVKVEEPFQGLFTQGMVLAWTDFGPVEVEGSVVRLPEPTRIRLEIPESALSLEDVRKMGALH
1f9dA           ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
1ileA3          GVMLFG------SIAFKNVICHGLILDE------------------------------------KGQ---
1f4lA2          ----------------------------------------------------------------------
1bt1A           ERILGKLIGDPSFGLPFWNWDNPGGMVLPDFLNDSTSSLYDSNRNQSHLPPVVVDLGYNG----------
1h78A           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1j5qA1          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1f4lA1          ----------------------------------------------------------------------
2a6tA1          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
2a4hA1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------QIVHELYNDISISKDPKYS-----DILEVX
1a8hA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
2fiyA1          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          SVATRG------VSPYKFLLSHGFVMDGEGK---------------------------------------
1a8hA2          AVFWPTMLKAAGIPMYRHLNVGGFLLGPDG----------------------------------------
1gaxA3          AFYPGDVLVTGYDILFLW------VSRMEVSGYHFMGERPFKTVLLHGLVLDEKGQ--------------
1f4lA2          LEGS-------NFRKPSNLFVHGYVTVNGA----------------------------------------
1iq0A2          QFWKMGILEGLRFRPYENPYYPGLRTSAPEGEAYTPKAEETINVVDVRQSHPQALVRAALEGRQMSGAVS
1li5A2          STCA-------HDGQYVNYWMHSGMVMVDRE---------------------------------------


                         .         +         .         .         .         .         *:700
query           IGGIEKMSKSKNNGIDPQALIDQYGADTARLFVMFAAPPEQQLEWSGSGVEGASRFLRRVWNYGYANAQA
1h3nA3          LWKPAVMSKSKGNGVMVGPFVKEQGADIARITILFAAPPENEMVWTEEGVQGAWR---------------
1f9dA           ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
1ileA3          -----KMSKSKGNVVDPWDIIRKFGADALRWYIYVSAPPEADRRFGPNLVRETVR---------------
1f4lA2          ----------------------------------------------------------------------
1bt1A           ADTDVTDQQRITDNLALMYKQMVTNAGTAELFLGKAYRAGDAPSPGAGSIETSPHIPIHRWVGDPRN---
1h78A           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1j5qA1          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------VYSFFVTYANLDRPDLKN
1euqA2          ------MSKRKLNLLVTDKHVEGWDDPRMPTISGLRRR-----GYTAASIREFCKRIGVTKQ--------
1h3nA1          -------------------------------------------------------FLNRIYRRVAEDREA
1rqgA1          ------------------------------------------------------NFVHRALTFVNRYFDG
1f4lA1          -------------------------------------------------------LASRNAGFINKRFDG
2a6tA1          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
2a4hA1          ----------------------------------------------------------------------
2bl7A1          QKVYLKLEKQKYE-LDPSPLINRL-----VNYLYFTAYTNKIFTEYQEELIR------------------
1a8hA1          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1ffyA1          ----------------------------------------------------------------------
1gaxA5          ----------------------------------------------------------------------
1pzdA1          ----------------------------------------------------------------------
2fiyA1          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          -----KMSKSLGNVIVPDQVVKQKGADIARLWVSS-TDYLADVRISDEILKQTS----------------
1a8hA2          ----RKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEA--------------
1gaxA3          -----KMSKSKGNVIDPLEMVERYGADALRFALIYLATGGQDIRLDLRWLEMARNF--------------
1f4lA2          -----KMSKSRGTFIKASTWLNHFDADSLRYYYTAKLSSRDDIDLNLEDFVQRVNA--DIVN--------
1iq0A2          VDEVAIVEEKNPDHPDKEEAARMVALGAIRFSMV-KTEPKKQIDFRYQEALSF-----------------
1li5A2          -----KMSKSLGNFFTVRDVLKYYDAETVRYF-LMSGHYRSQLNYSEENLKQA-----------------


                         .         .         .         .         +         .         .:770
query           IRXXXXXXXXXXXXXLRREIHTVLKQANYDYERIQYNTVVSATMKMLNALEDAKTASPAGRREGFSVLLR
1h3nA3          ----------------------------------------------------------------------
1f9dA           ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
1h78A           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1j5qA1          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1ileA1          P--PPPEKRPEMDRWLLARMQDLIQRVTEALEAYDPTTSARALRDFVVEDALDREAAYATLYEALVLVAT
1euqA2          ----------------------------------------------------------------------
1h3nA1          LLETSGVFQAEALEGLYGKLHETLKKVTEDLEALRFNTAIAALMEFLNALYEYDRPVTPVYRTAIRYYLQ
1rqgA1          VVPERGELDELDREALE-EIEKAFKEVGELIMNYRFKDALKRVMSLASFGKVRTGTTVNISLQIVKALGI
1f4lA1          V-----LASELADPQLYKTFTDAAEVIGEAWESREFGKAVREIMALADLANRYQEGRDADLQNLFRVLMT
2a6tA1          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
2a4hA1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1a8hA1          -----------------------------LVRELKFHVALEEAMAYVKAINEKKKKEPEEARAVLYRVSI
1g59A2          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1ffyA1          ------------------RLREFTASTINNYENFDYLNIYQEVQNFINVLDYGKQRDSHIRRSMQTVLTK
1gaxA5          -------------------------------------------------LKAGNAHTLRTLEEVLAVLLK
1pzdA1          ----------------------------------------------------------------------
2fiyA1          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           VLYPVVPHIAHGLWQELGYAAETVDILDAAWPQVDEAALVRSEIELVLQVNGKVRGSLTVxxxxxxxxxx
1h3nA3          ----------------------------------------------------------------------
1f9dA           ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1h3nA2          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1ffyA2          ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1bt1A           ----------------------------------------------------------------------
1h78A           ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1j5qA1          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1gaxA2          ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1ileA2          ----------------------------------------------------------------------
1a1xA           ----------------------------------------------------------------------
1ileA1          LAAPFTPFLAEVLWQNLVRSVAKESVHLADWPEADPALALVAQMRAVLKVVDLARAARAK----------
1euqA2          ----------------------------------------------------------------------
1h3nA1          MLFPFAPHLAEELWHWFWPD----SLFEAGWPELDEKALEK-----------------------------
1rqgA1          LLEPFLPDASEKIWHLLNLDEV-KRWEFRELPAGHKVRTDDQIIYFILNYMAKGN---------------
1f4lA1          YLKPVLPKLTERAEAFLN---TELTWDGIQQPLLGH-KVNPFKALYNRIDMRQVEALVEA----------
2a6tA1          ----------------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
1fl7B           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
2a4hA1          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1a8hA1          LLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIPEEAPVL------------------------
1g59A2          ----------------------------------------------------------------------
1x6mA           ----------------------------------------------------------------------
1b25A1          ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1ffyA1          LLAPILVHTAEEVWSHTPHVKEE-SVHLADMPKVVEVALL-DKWRTFMNLRDDVNRAL------------
1gaxA5          LLHPMMPFLTSELYQAL-TGKEELAL--EAWPEPGGREEAERAFEALKQAVTAVR---------------
1pzdA1          ----------------------------------------------------------------------
2fiyA1          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1a8hA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1h3nA3          ---------------------------------
1f9dA           ---------------------------------
1ffyA3          ---------------------------------
1a8hA2          ---------------------------------
1gaxA3          ---------------------------------
1h3nA2          ---------------------------------
1rqgA2          ---------------------------------
1n1bA2          ---------------------------------
1j1uA           ---------------------------------
1ffyA2          ---------------------------------
1ileA3          ---------------------------------
1f4lA2          ---------------------------------
1bt1A           ---------------------------------
1h78A           ---------------------------------
1d2rA           ---------------------------------
1iq0A2          ---------------------------------
1li5A2          ---------------------------------
1qmyA           ---------------------------------
1j5qA1          ---------------------------------
1irxA2          ---------------------------------
2p84A1          ---------------------------------
1gaxA2          ---------------------------------
1jfaA           ---------------------------------
1c4kA1          ---------------------------------
1ileA2          ---------------------------------
1a1xA           ---------------------------------
1ileA1          ---------------------------------
1euqA2          ---------------------------------
1h3nA1          ---------------------------------
1rqgA1          ---------------------------------
1f4lA1          ---------------------------------
2a6tA1          ---------------------------------
1bs2A2          ---------------------------------
1fl7B           ---------------------------------
1nzjA           ---------------------------------
2a4hA1          ---------------------------------
2bl7A1          ---------------------------------
1a8hA1          ---------------------------------
1g59A2          ---------------------------------
1x6mA           ---------------------------------
1b25A1          ---------------------------------
1edzA2          ---------------------------------
1ffyA1          ---------------------------------
1gaxA5          ---------------------------------
1pzdA1          ---------------------------------
2fiyA1          ---------------------------------
1h3nA3          ---------------------------------
1ffyA3          ---------------------------------
1a8hA2          ---------------------------------
1gaxA3          ---------------------------------
1f4lA2          ---------------------------------
1iq0A2          ---------------------------------
1li5A2          ---------------------------------