[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE37468.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a32A.bssp"
#ERROR : Can't open dsspfile "1vs5O.bssp"
#ERROR : Can't open dsspfile "2qalO.bssp"
#ERROR : Can't open dsspfile "2gy9O.bssp"
#ERROR : Can't open dsspfile "2j00O.bssp"
#ERROR : Can't open dsspfile "2zkqo.bssp"
#ERROR : Can't open dsspfile "1g1xB.bssp"
#ERROR : Can't open dsspfile "1kuqA.bssp"
#ERROR : Can't open dsspfile "3bbnO.bssp"
#ERROR : Can't open dsspfile "1dk1A.bssp"

## Summary of PDB Search
:89
    5e-23  56%  1a32A  [x.x.x] RIBOSOMAL PROTEIN S15
    7e-23  52%  1vs5O  [x.x.x] 30S RIBOSOMAL PROTEIN S15
    7e-23  52%  2qalO  [x.x.x] 30S RIBOSOMAL PROTEIN S15
    8e-22  51%  2gy9O  [x.x.x] 30S RIBOSOMAL SUBUNIT PROTEIN S15
    1e-17  50%  2j00O  [a.16.1 (1fjgO)] 30S RIBOSOMAL PROTEIN S15
    6e-17  50%  2zkqo  [x.x.x] 40S RIBOSOMAL PROTEIN S13E
    2e-16  47%  1g1xB  [a.16.1] 30S RIBOSOMAL PROTEIN S15
    4e-16  49%  1kuqA  [a.16.1] 30S RIBOSOMAL PROTEIN S15
    4e-11  44%  3bbnO  [x.x.x] RIBOSOMAL PROTEIN S15
    4e-09  57%  1dk1A  [a.16.1] 30S RIBOSOMAL PROTEIN S15
:89

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSITAERKAEVIQGNANKAGDTGSPEVQVAILSERIVNLTAHFKTHTKDNHSRRGLLKLVSTRRSLLDYV
1a32A           --LTQERKREIIEQFKVHENDTGSPEVQIAILTEQINNLNEHLRVHKKDHHSRRGLLKMVGKRRRLLAYL
1vs5O           -SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
2qalO           -SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
2gy9O           --LSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVSQRRKLLDYL
2j00O           --ITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGXXXXXXXXX
2zkqo           --ITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGXXXXXXXXX
1g1xB           --ITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGXXXXXXXXX
1kuqA           -----EEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGXXXXXXXXX
3bbnO           -----------------KEENKGSVEFQVFCFTNKIRRLTLHLELHKKDYSSQRGLRKTLGKRQRLLAYL
1dk1A           --ITKEEKQKV-QEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHS------------------


                         .         .         *         .         .         .         .:140
query           KKKDEARYKALLEKHNIRR
1a32A           RNKDVARYREIVEK-----
1vs5O           KRKDVARYTRLIERLGLRR
2qalO           KRKDVARYTQLIERLGLRR
2gy9O           KRKDVARYTQLIERLGLR-
2j00O           XXEDPERYRALIEKLGIR-
2zkqo           XXEDPERYRALIEK-----
1g1xB           XXEDPERYREIVEKLGLR-
1kuqA           XXEDPERYRALIEKLGI--
3bbnO           LKINGVRYKELISKLNIR-
1dk1A           -------------------