[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE37597.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2istA.bssp"
#ERROR : Can't open dsspfile "1v9fA.bssp"
#ERROR : Can't open dsspfile "1qyuA.bssp"
#ERROR : Can't open dsspfile "1przA.bssp"
#ERROR : Can't open dsspfile "1xpiA.bssp"
#ERROR : Can't open dsspfile "1xpiB.bssp"
#ERROR : Can't open dsspfile "1v9kA.bssp"
#ERROR : Can't open dsspfile "2i82C.bssp"
#ERROR : Can't open dsspfile "2i82B.bssp"
#ERROR : Can't open dsspfile "2i82A.bssp"
#ERROR : Can't open dsspfile "2omlA.bssp"
#ERROR : Can't open dsspfile "2olwB.bssp"
#ERROR : Can't open dsspfile "2olwA.bssp"

## Summary of PDB Search
:426
    1e-47  44%  2istA  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    4e-41  47%  1v9fA  [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    6e-32  48%  1qyuA  [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    7e-31  48%  1przA  [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE D
    3e-22  37%  1xpiA  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
    3e-22  37%  1xpiB  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
    2e-20  37%  1v9kA  [d.265.1] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE C
    6e-18  44%  2i82C  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE A
    6e-18  44%  2i82B  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE A
    6e-18  44%  2i82A  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE A
    9e-04  36%  2omlA  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE E
    9e-04  36%  2olwB  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE E
    9e-04  36%  2olwA  [x.x.x] RIBOSOMAL LARGE SUBUNIT PSEUDOURIDINE SYNTHASE E
:426

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2istA           ----------------------------------------------------------------------
1v9fA           ----------------------------------------------------------------------
1qyuA           ----------------------------------------------------------------------
1przA           ----------------------------------------------------------------------
1xpiA           ----------------------------------------------------------------------
1xpiB           ----------------------------------------------------------------------
1v9kA           ----------------------------------------------------------------------
2i82C           ----------------------------------------------------------------------
2i82B           ----------------------------------------------------------------------
2i82A           ----------------------------------------------------------------------
2omlA           ----------------------------------------------------------------------
2olwB           ----------------------------------------------------------------------
2olwA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLEVVVAGDEGSPRLDRVLATRCPALSRSRLKALILDGRVA
2istA           ------------------------------LTATVSENQLGQRLDQALAEMFPDYSRSRIKEWILDQRVL
1v9fA           ----------------------------------------------------------------------
1qyuA           ----------------------------------------------------------------------
1przA           ----------------------------------------------------------------------
1xpiA           ----------------------------------------------------------------------
1xpiB           ----------------------------------------------------------------------
1v9kA           ----------------------------------------------------------------------
2i82C           ----------------------------------------------------------------------
2i82B           ----------------------------------------------------------------------
2i82A           ----------------------------------------------------------------------
2omlA           ----------------------------------------------------------------------
2olwB           ----------------------------------------------------------------------
2olwA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           IRGAPVRDPAYHAASGETITIDXXXXXXXXXXXXXXXLXXXXXXXXXXXXXKPRGLVVHPAAGHETGTLV
2istA           VNGKVCDKPKEKVLGGEQVAINAEIERFEPQDIP---LDIVYXXXXXXXXNKPRDLVVHPGAGNPDGTVL
1v9fA           ---------------------------------------------------KPRDLVVHPGAGNPDGTVL
1qyuA           ---------------------------------------------------KPRDLVVHPGAGNPDGTVL
1przA           ---------------------------------------------------KPRDLVVHPGAGNPDGTVL
1xpiA           ---------------------------------------------------KPSGTAVHGGSGLSFGVI-
1xpiB           ---------------------------------------------------KPSGTAVHGGSGLSFG-VI
1v9kA           ---------------------------------------------------KPSGTAVHGGSGLSFG-VI
2i82C           ----------------------------------------------------------------------
2i82B           ----------------------------------------------------------------------
2i82A           ----------------------------------------------------------------------
2omlA           ----------------------------------------------------------------------
2olwB           ----------------------------------------------------------------------
2olwA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           NALIAHCGESLSGIGGVRRPGIVHRLDKDTTGLMVAAKNDRAHQSLSAQFADHGRTGELRRGYYAFVWGA
2istA           NALLHY----YPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESL----QRREITREYEAVAIGH
1v9fA           NALLHY----YPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESL----QRREITREYEAVAIGH
1qyuA           NALLHY----YPPIADVPRAGIVHRLDKDTTGLVVA-------KTVPAQLVESLQRREITREYEAVAIG-
1przA           NALLHY----YPPIADVPRAGIVHRLDKDTTGLVVA-------KTVPAQLVESLQRREITREYEAVAIG-
1xpiA           --------EGLRALRA-RFLELVHRLDRDTSGVLLVAKKRSALRSLHEQLREKG----MQKDYLALVRGQ
1xpiB           EGLRALRPEA-------RFLELVHRLDRDTSGVLLVAKKRSALRSLHEQLREKG----MQKDYLALVRGQ
1v9kA           EGLRALRPEA-------RFLELVHRLDRDTSGVLLVAKKRSALRSLHEQLREKGQ-----KDYLALVRGQ
2i82C           ----------------------VHRLDA-TSGVIVVALTKAAERELKRQF----REREPKKQYVARVWGH
2i82B           ----------------------VHRLDA-TSGVIVVALTKAAERELKRQF----REREPKKQYVARVWGH
2i82A           ----------------------VHRLDA-TSGVIVVALTKAAERELKRQF----REREPKKQYVARVWGH
2omlA           ------------------------RLDRDSEGLLVLTNNG----ALQARLTQPGRTGKI---YYVQVEGI
2olwB           ------------------------RLDRDSEGLLVLTNNG----ALQARLTQPGRTGKI---YYVQVEGI
2olwA           ------------------------RLDRDSEGLLVLTNNG----ALQARLTQPGRTGKI---YYVQVEGI


                         .         *         .         .         .         .         +:350
query           PNRIRGTIDAPIDRHPHAREKMAVRDGGREAITHWEVLETFTGRSGGEIVSLIACQLETGRTHQIRVHLA
2istA           MTA-GGTVDEPISRHPTKRTHMAVHPMGKPAVTHYRIMEHF------RVHTXXXXXXETGRTHQIRVHMA
1v9fA           MTA-GGTVDEPISRHPTKRTHMAVHPMGKPAVTHYRIMEHF------RVHTXXXXXXETGRTHQIRVHMA
1qyuA           -HTAGGTVDEPISRHPTKRTH-AVHPMGKPAVTHYRI-EHF------RVHTXXXXXXETGRTHQIRVH-A
1przA           -HTAGGTVDEPISRHPTKRTHAV--HPGKPAVTHYRI-EHF------RVHTXXXXXXETGRTHQIRVH-A
1xpiA           WQSHVKSVQAPLLKNILQSGERIVRQEGKPSETRFKVEERYA------FATLVRCSPVTGRTHQIRVHTQ
1xpiB           WQSHVKSVQAPLLKNILQSGERIVRQEGKPSETRFKVEERYA------FATLVRCSPVTGRTHQIRVHTQ
1v9kA           WQSHVKSVQAPLLKNILQSGERIVRQEGKPSETRFKVEERYA------FATLVRCSPVTGRTHQIRVHTQ
2i82C           PSPAEGLVDLPICDWPNRPKQKVCYETGKPAQTEYEVVEYAADNTARVVLKPI-----TGRSHQLRVHLA
2i82B           PSPAEGLVDLPICDWPNRPKQKVCYETGKPAQTEYEVVEYAADNTARVVLKPI-----TGRSHQLRVHLA
2i82A           PSPAEGLVDLPICDWPNRPKQKVCYETGKPAQTEYEVVEYAADNTARVVLKPI-----TGRSHQLRVHLA
2omlA           PTQ---------DALEALRNGVTLNDGGAELVDEWLWPRNPPIRRKSIPTSWLKITLYEGRNRQVRRMTA
2olwB           PTQ---------DALEALRNGVTLNDGGAELVDEWLWPRNPPIRRKSIPTSWLKITLYEGRNRQVRRMTA
2olwA           PTQ---------DALEALRNGVTLNDGGAELVDEWLWPRNPPIRRKSIPTSWLKITLYEGRNRQVRRMTA


                         .         .         .         .         *         .         .:420
query           HIGHPLLGDDVYGPHFKTKASQLRPDARAALTDLGRQALHAYLLVLEHPSTGEVVAWESGLPADLKRLKA
2istA           HITHPLVGDPVYGPRPPKGASEA---FISTLRKFDRQALHATMLRLYHPISGIEMEWHAPIPQDMVELIE
1v9fA           HITHPLVGDPVYGPRPPKGASEA---FISTLRKFDRQALHATMLRLYHPISGIEMEWHAPIPQDMVELIE
1qyuA           HITHPLVGDPVYGPRPPKGASEA---FISTLRKFDRQALHA-TLRLYHPISG-IEEWHAPIPQDVELIE-
1przA           HITHPLVGDPVYGPRPPKGASEA---FISTLRKFDRQALHA-TLRLYHPISG-IEEWHAPIPQDVELIE-
1xpiA           YAGHPIAFDDRYGDR------EFDRQLTEAGTGLNRLFLHAAALKFTHPGTGEVMRIEAPMDEGLKR---
1xpiB           YAGHPIAFDDRYGDR------EFDRQLTEAGTGLNRLFLHAAALKFTHPGTGEVMRIEAPMDEGLKR---
1v9kA           YAGHPIAFDDRYGDR------EFDRQLTEAGTGLNRLFLHAAALKFTHPGTGEVEAPDEGLKRCLQKRNA
2i82C           -LGHPILGDRFYA----------SPEARAA----PRLLLHAE-LTITHPAYG------------------
2i82B           -LGHPILGDRFYA----------SPEARAA----PRLLLHAE-LTITHPAYG------------------
2i82A           -LGHPILGDRFYA----------SPEARAA----PRLLLHAE-LTITHPAYG------------------
2omlA           HVGFPTL---------------------------------------------------------------
2olwB           HVGFPTL---------------------------------------------------------------
2olwA           HVGFPTL---------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ALTAxx
2istA           VMRA--
1v9fA           VMRA--
1qyuA           ------
1przA           ------
1xpiA           ------
1xpiB           ------
1v9kA           ------
2i82C           ------
2i82B           ------
2i82A           ------
2omlA           ------
2olwB           ------
2olwA           ------