[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE37710.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2gbsA.bssp"
#ERROR : Can't open dsspfile "1zceA.bssp"
#ERROR : Can't open dsspfile "2ar1A.bssp"
#ERROR : Can't open dsspfile "3eopB.bssp"
#ERROR : Can't open dsspfile "3eopA.bssp"
#ERROR : Can't open dsspfile "2g2xA.bssp"
#ERROR : Can't open dsspfile "2eveA.bssp"

## Summary of PDB Search
:137
    1e-63  79%  2gbsA  [x.x.x] HYPOTHETICAL PROTEIN RPA0253
    7e-25  50%  1zceA  [x.x.x] HYPOTHETICAL PROTEIN ATU2648
    3e-17  41%  2ar1A  [x.x.x] HYPOTHETICAL PROTEIN
    1e-13  35%  3eopB  [x.x.x] THYMOCYTE NUCLEAR PROTEIN 1
    5e-12  34%  3eopA  [x.x.x] THYMOCYTE NUCLEAR PROTEIN 1
    7e-11  52%  2g2xA  [x.x.x] HYPOTHETICAL PROTEIN PP5205
    1e-09  38%  2eveA  [x.x.x] HYPOTHETICAL PROTEIN PSPTO5229
:137

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAYWLVKSEPSVWSWDQQVAKGAKGEAWTGVRNHSAKLHMIAMKKGDRAFFYHSNXXXXXXXXXXXXXXX
2gbsA           VAYWLVKSEPSVWSWDQQVAKGAAGEAWTGVRNHSAKLHMVAMRRGDRAFYYHSNEGKEIVGIAEIIREA
1zceA           --YWLYKSEPFKWSWEQK-AKGETGEEWTGVRNYQARNN--RAKIGDKGFFYHSNEGLDVVGIVEVCALS
2ar1A           --YWLLKSEPHKFSIDDLAKQ--KTSPWDGVRNYAARNNMRAMSVGDKVLFYHSNTKEPGVAGLAEVVRL
3eopB           -SHWLMKSEPDVFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNKEPGIAGLMKIVKEA
3eopA           -SHWLMKSEPESFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNKEPGIAGLMKIVKEA
2g2xA           -AYWL-KSEPDELSIE---ALARLGEAWDGVRNYQAR-NFLRASVGDEFFFYHSSCPQPXXXXXXXXXXX
2eveA           -AYWL-KSEPDEFSISDLQRLGKA--RWDGVRNYQAR-NFLRTAEGDEFFFYHSSCPEPGIAGIGKIVKT


                         .         .         *         .         .         .         .:140
query           YPDPTDESGKFVCVDLKADKKLKTPVTLVAVKAEPRLAEMALLKYSRLSVQPVTADEWKLICKMGGL
2gbsA           YPDPTDASGKFVCVDIKADKPLKTPVTLAAVKAEPRLADMALMKYSRLSVQPVTAEEWKLVCKMGGL
1zceA           HPDSTAEGDKWDCVDIRAVCD-PQPVSLKDVKANPKLEKS--LVTSRLSVQPVTEEEYLEVCR-GGL
2ar1A           YFDPTKEKNPWKMVDVKFVARWDTVLTLHELKSRRELQKMALFTQRRLSVQPVSASEYAYILRM---
3eopB           YPDHTEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQLKNMVLFTRQRLSIQPLTQEEFDFVLSL---
3eopA           YPDHTEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQLKNMVLFTRQRLSIQPLTQEEFDFVLSL---
2g2xA           YPDPTALDPESHYHDAKADKNPWSAVDVAHVQTFPRVLELGRLKQSRLSV-PVTPEQWAVI------
2eveA           YPDPTTEKNPWSALDIGFVDIFKNVLGLGYLKQQSQLEQLPLVKGSRLSV-PVTAEQWAAI------