[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE37723.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1w7eA.bssp"
#ERROR : Can't open dsspfile "1w7dA.bssp"
#ERROR : Can't open dsspfile "1nyoA.bssp"
#ERROR : Can't open dsspfile "1x3bA.bssp"
#ERROR : Can't open dsspfile "2vxpA.bssp"
#ERROR : Can't open dsspfile "1o70A.bssp"

## Summary of PDB Search
:194
    1e-29  59%  1w7eA  [x.x.x] FASCICLIN-LIKE PROTEIN
    1e-29  59%  1w7dA  [x.x.x] FASCICLIN-LIKE PROTEIN
    2e-18  46%  1nyoA  [b.118.1] IMMUNOGENIC PROTEIN MPT70
    2e-07  31%  1x3bA  [x.x.x] TRANSFORMING GROWTH FACTOR-BETA INDUCED PROTEIN
    3e-06  30%  2vxpA  [x.x.x] TRANSFORMING GROWTH FACTOR-BETA-INDUCED PROTEIN
    1e-05  30%  1o70A  [b.118.1 - b.118.1] FASCICLIN I
:194

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1w7eA           ----------------------------------------------------------------------
1w7dA           ----------------------------------------------------------------------
1nyoA           ----------------------------------------------------------------------
1x3bA           ----------------------------------------------------------------------
2vxpA           ----------------------------------------------------------------------
1o70A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxEGKGPFTVFAPTNAAFGKLPAGTVDTLVKPESKATLTKILTYHVVPGKLAAADLTDG
1w7eA           -------------KGDGPFTVFAPTDAAFAALPEGTVEDLLKPENKEKLTEILTYHVVPGEVMSSDLTEG
1w7dA           -------------KGDGPFTVFAPTDAAFAALPEGTVEDLLKPENKEKLTEILTYHVVPGEVMSSDLTEG
1nyoA           ----------------GQYTVFAPTNAAFSKLPASTIDEL--KTNSSLLTSILTYHVVAGQTSPANVVGT
1x3bA           ---------------EGVYTVFAPTNEAFRALPPRERSRLLGDAKE--LANILKYHIGDEILVSGGIGAL
2vxpA           ---------------EGVYTVFAPTNEAFRALPPRERSRLLGDAKE--LANILKYHIGDEILVSGGIGAL
1o70A           -------------------TILAPSNEAWN---SSNINNVLRDRNK--MRQILNMHIIKDRLNVDKIRQK


                         +         .         .         .         .         *         .:210
query           KKLTTVEGATLTVKRSGDQVMLVDAKGGSSTVTIPNVNQSNGVIHVVDTVLMPS
1w7eA           MTAETVEGGALTVTLEG------GPKVNGVSISQPDVDASNGVIHVIDGVLMP-
1w7dA           MTAETVEGGALTVTLEG------GPKVNGVSISQPDVDASNGVIHVIDGVLMP-
1nyoA           RQ--TLQGASVTVTGQGNSL-----KVGNADVVCGGVSTANATVYMIDSVLMP-
1x3bA           VRLKSLQG-----DKXXXXXXXXXXXXXXXPVAEPDIMATNGVVHVITNVLQPS
2vxpA           VRLKSLQG-----DKXXXXXXXXXXXXXXXPVAEPDIMATNGVVHVITNVL---
1o70A           NQVPTVNNNTFNVRGEGDTVITVEGGGVNATVIQADVAQTNGYVHIIDHVL---