[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE37731.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2qz9B.bssp"
#ERROR : Can't open dsspfile "2qz9A.bssp"
#ERROR : Can't open dsspfile "2r00C.bssp"
#ERROR : Can't open dsspfile "2r00A.bssp"
#ERROR : Can't open dsspfile "2r00B.bssp"
#ERROR : Can't open dsspfile "2yv3A.bssp"
#ERROR : Can't open dsspfile "2gz3C.bssp"
#ERROR : Can't open dsspfile "2gz3B.bssp"
#ERROR : Can't open dsspfile "2gz1A.bssp"
#ERROR : Can't open dsspfile "2gyyB.bssp"
#ERROR : Can't open dsspfile "2gyyA.bssp"
#ERROR : Can't open dsspfile "2gyyD.bssp"
#ERROR : Can't open dsspfile "2gyyC.bssp"
#ERROR : Can't open dsspfile "2hjsA.bssp"
#ERROR : Can't open dsspfile "2ep5D.bssp"
#ERROR : Can't open dsspfile "2ep5A.bssp"
#ERROR : Can't open dsspfile "1ys4A.bssp"
#ERROR : Can't open dsspfile "1mb4A.bssp"
#ERROR : Can't open dsspfile "1ta4A.bssp"
#ERROR : Can't open dsspfile "1nwcA.bssp"
#ERROR : Can't open dsspfile "1t4bA.bssp"
#ERROR : Can't open dsspfile "1gl3A.bssp"
#ERROR : Can't open dsspfile "1ps8A.bssp"
#ERROR : Can't open dsspfile "1pr3A.bssp"
#ERROR : Can't open dsspfile "1pquC.bssp"
#ERROR : Can't open dsspfile "1pquA.bssp"
#ERROR : Can't open dsspfile "1ozaA.bssp"
#ERROR : Can't open dsspfile "1pqpA.bssp"
#ERROR : Can't open dsspfile "1nx6A.bssp"
#ERROR : Can't open dsspfile "1nwhA.bssp"
#ERROR : Can't open dsspfile "1q2xA.bssp"
#ERROR : Can't open dsspfile "1pu2A.bssp"
#ERROR : Can't open dsspfile "1brmC.bssp"
#ERROR : Can't open dsspfile "1brmB.bssp"
#ERROR : Can't open dsspfile "1brmA.bssp"
#ERROR : Can't open dsspfile "2g17A.bssp"
#ERROR : Can't open dsspfile "1vknA.bssp"
#ERROR : Can't open dsspfile "3dr3A.bssp"
#ERROR : Can't open dsspfile "1vknC.bssp"
#ERROR : Can't open dsspfile "1vknD.bssp"
#ERROR : Can't open dsspfile "1xygA.bssp"
#ERROR : Can't open dsspfile "2cvoD.bssp"
#ERROR : Can't open dsspfile "2cvoA.bssp"
#ERROR : Can't open dsspfile "3gpdR.bssp"

## Summary of PDB Search
:344
    3e-89  51%  2qz9B  [x.x.x] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    3e-89  51%  2qz9A  [x.x.x] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    7e-87  51%  2r00C  [x.x.x] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    3e-80  52%  2r00A  [x.x.x] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    2e-77  52%  2r00B  [x.x.x] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    7e-66  44%  2yv3A  [x.x.x] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    8e-56  40%  2gz3C  [x.x.x] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE
    8e-56  40%  2gz3B  [x.x.x] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE
    8e-56  40%  2gz1A  [x.x.x] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE
    7e-55  42%  2gyyB  [x.x.x] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE
    2e-53  40%  2gyyA  [x.x.x] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE
    8e-53  39%  2gyyD  [x.x.x] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE
    1e-51  39%  2gyyC  [x.x.x] ASPARTATE BETA-SEMIALDEHYDE DEHYDROGENASE
    3e-38  32%  2hjsA  [x.x.x] USG-1 PROTEIN HOMOLOG
    3e-27  34%  2ep5D  [x.x.x] 350AA LONG HYPOTHETICAL ASPARTATE-SEMIALDEHYDE
    3e-27  34%  2ep5A  [x.x.x] 350AA LONG HYPOTHETICAL ASPARTATE-SEMIALDEHYDE
    4e-25  35%  1ys4A  [x.x.x] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    1e-23  30%  1mb4A  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    4e-21  31%  1ta4A  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    4e-21  31%  1nwcA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    7e-21  29%  1t4bA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    7e-21  29%  1gl3A  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    9e-21  31%  1ps8A  [c.2.1 - d.81.1] ASPARTATE SEMIALDEHYDE DEHYDROGENASE
    9e-21  31%  1pr3A  [c.2.1 - d.81.1] ASPARTATE SEMIALDEHYDE DEHYDROGENASE
    2e-20  31%  1pquC  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    2e-20  31%  1pquA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    2e-20  31%  1ozaA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    6e-20  31%  1pqpA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    2e-19  31%  1nx6A  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    2e-19  31%  1nwhA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    5e-19  31%  1q2xA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    5e-19  31%  1pu2A  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    2e-18  30%  1brmC  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    6e-17  29%  1brmB  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    3e-16  29%  1brmA  [c.2.1 - d.81.1] ASPARTATE-SEMIALDEHYDE DEHYDROGENASE
    2e-08  30%  2g17A  [x.x.x] N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE
    3e-07  29%  1vknA  [c.2.1 - d.81.1] N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE
    3e-06  34%  3dr3A  [x.x.x] N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE
    8e-06  28%  1vknC  [c.2.1 - d.81.1] N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE
    3e-05  26%  1vknD  [c.2.1 - d.81.1] N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE REDUCTASE
    2e-04  22%  1xygA  [c.2.1 - d.81.1] PUTATIVE N-ACETYL-GAMMA-GLUTAMYL-PHOSPHATE
    2e-04  27%  2cvoD  [x.x.x] PUTATIVE SEMIALDEHYDE DEHYDROGENASE
    2e-04  27%  2cvoA  [x.x.x] PUTATIVE SEMIALDEHYDE DEHYDROGENASE
    6e-04  34%  3gpdR  [c.2.1 - d.81.1] D-GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE
:344

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xGYKVAVVGATGNVGREMLAILDERKFPADEVVALASRRSIGVEVSYGDKTLKCKALEHYDFSDVDICLM
2qz9B           --FNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALF
2qz9A           --FNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALF
2r00C           --FNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALF
2r00A           --FNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALF
2r00B           --FNVAIFGATGAVGETMLEVLQEREFPVDELFLLASERSEGKTYRFNGKTVRVQNVEEFDWSQVHIALF
2yv3A           ---------------REILKVLEARNFPLSELRLYASPRSAGVRLAFRGXXXXXXXXXXXXXXXXXXXA-
2gz3C           ----------------QMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDXXXXXXXXXAFEGVDIALF
2gz3B           ----------------QMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDXXXXXXXXXAFEGVDIALF
2gz1A           ----------------QMIKMLEESTLPIDKIRYLASARSAGKSLKFKDQDXXXXXXXXXAFEGVDIALF
2gyyB           -GYTVAVVGATG---AQMIKMLEESTLPIDKI-------------RYLDQDXXXXXXXXXAFEGVDIALF
2gyyA           ----------------QMIKMLEESTLPIDKIRYLASGKSL----KFKDQDXXXXXXXXXAFEGVDIALF
2gyyD           ----------------QMIKMLEESTLPIDKI------RYLGKSLKFKDQDXXXXXXXXXAFEGVDIALF
2gyyC           ----------------QMIKMLEESTLPIDKI------RYLGKSLKF-DQDXXXXXXXXXAFEGVDIALF
2hjsA           ----VAVVGATGSVGEALVGLLDERDFPLHRLHLLASAESAG-QRGFAESSLRVGDVDSFDFSSVGLXXX
2ep5D           ---KVSLLGSTGMVGQKMVKML--AKHPYLELVKVASPSKIGKKIEQGDQDLPIVSTNYEDHKDVDVVLS
2ep5A           ---KVSLLGSTGMVGQKMVKML--AKHPYLELVKVASPSKIGKKIEQGDQDLPIVSTNYEDHKDVDVVLS
1ys4A           ---KVGVLGATGSVGQRFVQLLADHPF---ELTALASERSAGKKYKFQDRDIPENIKDHEEFEDVDIVFS
1mb4A           ---RVGLVGWRGMVGSVLMQMVEERDFDLIEPVFFSTSQ-IGVPANFGDAGMLHDAFDIESLKQLDAVIT
1ta4A           -------------------------------------------------------AFDIEELKKLDIIVT
1nwcA           -------------------------------------------------------AFDIEELKKLDIIVT
1t4bA           ----VGFIGWRGMVGSVLMQMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQAFDLEALKALDIIVT
1gl3A           ----VGFIGWRGMVGSVLMQMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQAFDLEALKALDIIVT
1ps8A           -------------------------------------------------------AFDIEELKKLDIIVT
1pr3A           -------------------------------------------------------AFDIEELKKLDIIVT
1pquC           -------------------------------------------------------AFDIEELKKLDIIVT
1pquA           -------------------------------------------------------AFDIEELKKLDIIVT
1ozaA           -------------------------------------------------------AFDIEELKKLDIIVT
1pqpA           -------------------------------------------------------AFDIEELKKLDIIVT
1nx6A           -------------------------------------------------------AFDIEELKKLDIIVT
1nwhA           -------------------------------------------------------AFDIEELKKLDIIVT
1q2xA           -------------------------------------------------------AFDIEELKKLDIIVT
1pu2A           -------------------------------------------------------AFDIEELKKLDIIVT
1brmC           ----VGFIGWRGMVGSVLMQMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQAFDLEALKALDIIVT
1brmB           ----VGFIGWRGMVGSVLMQMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQAFDLEALKALDIIVT
1brmA           ----VGFIGWRGMVGSVLMQMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQAFDLEALKALDIIVT
2g17A           ------IVGASGYAGAELVSYVNRHPHTITALTVSAQSNDAGKLISKGIVDLPLQPSDVRDFSDVDVVFL
1vknA           ---RAGIIGATGYTGLELVRLL--KNHPEAKITYLSSRTYAGKKLEIFPSTLENSILSEFDPEKVDVLFT
3dr3A           ------IVGASGYAGAELVTYVN--RHPHMNITALAQSNDAGKLISDLHPQLKIVELPLQPMSDVDVVFL
1vknC           ---RAGIIGATGYTGLELVRLL--KNHPEAKITYLSSRTYAGKKLEIFPSTLENSILSEFDPEKVDVLFT
1vknD           ---RAGIIGATGYTGLELVRLL--KNHPEAKITYLSSRTYAGKKLEIFPSTLENSILSEFDPEKVDVLFT
1xygA           ---RIGLLGASGYTGAEIVRLLANH--PHFQVTLMTADRKAGQSMESVFPHLRAQKLKDADFSTVDAVFC
2cvoD           ---RIAVLGASGYTGAEIVRLL--ANHPQFRIKVMTADRKAGEQFGSVFPHLNLVAVKDADFSNVDAVFC
2cvoA           ---RIAVLGASGYTGAEIVRLL--ANHPQFRIKVMTADRKAGEQFGSVFPHLNLVAVKDADFSNVDAVFC
3gpdR           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SAGGAVSKEWSPQIGAQGAVVIDNSSAWRMDPDVPLIVPEVNAAAAAGFTKKNIIANPNCSTAQLVVALK
2qz9B           SAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRNRNIIANPNCSTIQMLVALK
2qz9A           SAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRNRNIIANPNCSTIQMLVALK
2r00C           SAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRNRNIIANPN-STIQMLVALK
2r00A           SAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRNRNIIANPNCSTIQMLVALK
2r00B           SAGGELSAKWAPIAAEAGVVVIDNTSHFRYDYDIPLVVPEVNPEAIAEFRNRNIIANPNCSTIQMLVALK
2yv3A           SAGGGISRAKALVWAEGGALVVDNSSAWRYEPWVPLVVPEVNREKI--FQHRGIIANPNCTTAILAMALW
2gz3C           SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHN--GIIACPNCSTIQMMVALE
2gz3B           SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHN--GIIACPNCSTIQMMVALE
2gz1A           SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHN--GIIACPNCSTIQMMVALE
2gyyB           SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHN--GIIACPNCSTIQMMVALE
2gyyA           SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHN--GIIACPNCSTIQMMVALE
2gyyD           SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHN--GIIACPNCSTIQMMVALE
2gyyC           SAGSSTSAKYAPYAVKAGVVVVDNTSYFRQNPDVPLVVPEVNAHALDAHN--GIIACPNCSTIQMMVALE
2hjsA           XXXXXXXXXXXXXXXXXGCSVIDLSGA--LEXXXXXXXXXXNAERLASQAAPFLLSSPCAVAAELCEVLA
2ep5D           ALPNELAESIELELVKNGKIVVSNASPFRMDPDVPLINPEINHLELLKFQKERLVKNPNCTAAIMSMPIK
2ep5A           ALPNELAESIELELVKNGKIVVSNASPFRMDPDVPLINPEINHLELLKFQKERLVKNPNCTAAIMSMPIK
1ys4A           ALPSDLAKKFEPEFAKEGKLIFSNASAYR-EEDVPLVIPEVNADHLELIEIQRIITNPNCSTICAVITLK
1mb4A           CQGGSYTEKVYPALRQAGGYWIDAASTLRMDKEAIITLDPVNLKQGIHHGTKTFVGG-NCTVSLMLMALG
1ta4A           CQGGDYTNEVYPKLKATGGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIFVGGNCTVSLMLMAIG
1nwcA           CQGGDYTNEVYPKLKATGGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIFVGGNCTVSLMLMAIG
1t4bA           CQGGDYTNEIYPKLRESGGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIFVGGNCTVSLMLMSLG
1gl3A           CQGGDYTNEIYPKLRESGGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIFVGGNCTVSLMLMSLG
1ps8A           CQGGDYTNEVYPKLKATGGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIFVGGNCTVSLMLMAIG
1pr3A           CQGGDYTNEVYPKLKATGGYWVDAASALKMKDDAIIVLDPVNQHVISEGLKKGIFVGGNCTVSLMLMAIG
1pquC           CQGGDYTNEVYPKLKATGGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIFVGGNCTVSLMLMAIG
1pquA           CQGGDYTNEVYPKLKATGGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIFVGGNCTVSLMLMAIG
1ozaA           CQGGDYTNEVYPKLKATGGYWVDAASALLMKDDAIIVLDPVNQHVISEGLKKGIFVGGNCTVSLMLMAIG
1pqpA           CQGGDYTNEVYPKLKATGGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIFVGGNSTVSLMLMAIG
1nx6A           CQGGDYTNEVYPKLKATGGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLAIG
1nwhA           CQGGDYTNEVYPKLKATGGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLAIG
1q2xA           CQGGDYTNEVYPKLKATGGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLAIG
1pu2A           CQGGDYTNEVYPKLKATGGYWVDAASALRMKDDAIIVLDPVNQHVISEGLKKGIKTFVGGNTVSLMLAIG
1brmC           CQGGDYTNEIYPKLRESGGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIFVGGNCTVSLMLMSLG
1brmB           CQGGDYTNEIYPKLRESGGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIFVGGNCTVSLMLMSLG
1brmA           CQGGDYTNEIYPKLRESGGYWIDAASSLRMKDDAIIILDPVNQDVITDGLNNGIFVGGNCTVSLMLMSLG
2g17A           ATAHEVSHDLAPQFLQAGCVVFDLSGAFRVNDGFTHQYPELLEQAVYGLAEANLIAVPGCYPTAAQLSLK
1vknA           ALPAGASYDLVREL--KGVKIIDLGADFRFDD--PGVYREWYGKELSGYENKNVVGNPGCYPTSVILALA
3dr3A           ATAHEVSHDLAPQFLEAGCVVFDLSGAFRVN-DATFYYPELLEQAAYGLAEANLIAVPGCYPTAAQLALK
1vknC           ALPAGASYDLVREL--KGVKIIDLGADFRFDD--PGVYREWYGKELSGYENKNVVGNPGCYPTSVILALA
1vknD           ALPAGASYDLVREL--KGVKIIDLGADFRFDD--PGVYREWYGKELSGYENKNVVGNPGCYPTSVILALA
1xygA           CLPHGTTQEIIKELPT-ALKIVDLSADFRLRNIAPHKAVELQKEVVYGLTKARLVANPGCYPTTIQLPLV
2cvoD           LPHGTTQEIIKGL--PQELKIVDLSADFRL-RDINEYAPELQQEAVYGLTEARLVANPGCYPTSIQLPLV
2cvoA           LPHGTTQEIIKGL--PQELKIVDLSADFRL-RDINEYAPELQQEAVYGLTEARLVANPGCYPTSIQLPLV
3gpdR           --------------GGAKRIVISAPSA-----DAPMFVMGVNHFKYANSLK--IISNASCTTNCLAPLAK


                         +         .         .         .         .         *         .:210
query           PLHDHAKITRVVVSTYQSVSGAGKEGMDELFSQTKAVYTNSELVNKKFPKRIAFNVIPEIDVFMEDGYTK
2qz9B           PIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNGYPAETNTFSQQIAFNCIPQIDQFMDNGYTK
2qz9A           PIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNGYPAETNTFSQQIAFNCIPQIDQFMDNGYTK
2r00C           PIYDAVGIERINVTTYQSVSGAGKAGIDELAGQTAKLLNGYPAETNTFSQQIAFNCIPQIDQFMDNGYTK
2r00A           PIYDAVGIERINVTTYQSVSGAGKAGID-----------------------------PQIDQFMDNGYTK
2r00B           PIYDAVGIERINVTTYQSVE------------------TNT------FSQQIAFNCIPQIDQFMDNGYTK
2yv3A           PLHRAFQAKRVIVATYQAASGAGAKAMEELLTETHRFLHGEAPKAEAFAHPLPFNVIPHIDAFQENGYTR
2gz3C           PVRQKWGLDRIIVSTYQAVSGAGRELREVLNDGVKPCDLHAEILPSGGDKKIAFNALPQIDVFTDDXXXX
2gz3B           PVRQKWGLDRIIVSTYQAVSGAGRELREVLNDGVKPCDLHAEILPSGGDKKIAFNALPQIDVFTDDXXXX
2gz1A           PVRQKWGLDRIIVSTYQAVSGAGRELREVLNDGVKPCDLHAEILPSGGDKKIAFNALPQIDVFTDDXXXX
2gyyB           PVRQKWGLDRIIVSTYQAVSGAGRELREVLNDGVKPCDLHAEILPSGGDKKIAFNALPQIDVFTDDXXXX
2gyyA           PVRQKWGLDRIIVSTYQAVSGAGRELREVLNDGVKPCDLHAEILPSGGDKKIAFNALPQIDVFTDDXXXX
2gyyD           PVRQKWGLDRIIVSTYQAVSGAGRELREVLNDGVKPCDLHAEILPSGGDKKIAFNALPQIDVFTDDXXXX
2gyyC           PVRQKWGLDRIIVSTYQAVSGAGRELREVLNDGVKPCDLHAEILPSGGDKKIAFNALPQIDVFTDDXXXX
2hjsA           PLLATLDCRQLNLTACLSVSSLGREGVKELARQTAELLNARPLEPRLFDRQIAFNLLAQVGAVDAEGHSA
2ep5D           PLIEIATKSKIIITTLQAVSGAGYNGISFM--------------------AIEGNIIPYIK-GEEDKIAK
2ep5A           PLIEIATKSKIIITTLQAVSGAGYNGISFM--------------------AIEGNIIPYIK-GEEDKIAK
1ys4A           PI-DKFGLEAVFIAT-QAVSGAGYNGV---------------------PSAILDNLIPFIK--NEEEKQT
1mb4A           GLYERGLVEWMSAMTYQAASGAGAQNMRELISQMGVIAVSSELANDNFGVPLAGSLIPWIDVKRDNGQSK
1ta4A           GLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLAVSSELIERKFGAALGGSLIPWIDKLLETGQTK
1nwcA           GLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLAVSSELIERKFGAALGGSLIPWIDKLLETGQTK
1t4bA           GLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR
1gl3A           GLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR
1ps8A           GLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLAVSSELIERKFGAALGGSLIPWIDKLLETGQTK
1pr3A           GLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLAVSSELIERKFGAALGGSLIPWIDKLLETGQTK
1pquC           GLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLAVSSELIERKFGAALGGSLIPWIDKLLETGQTK
1pquA           GLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLAVSSELIERKFGAALGGSLIPWIDKLLETGQTK
1ozaA           GLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLAVSSELIERKFGAALGGSLIPWIDKLLETGQTK
1pqpA           GLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLAVSSELIERKFGAALGGSLIPWIDKLLETGQTK
1nx6A           GLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLAVSSELIERKFGAALGGSLIPWIDKLLETGQTK
1nwhA           GLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLAVSSELIERKFGAALGGSLIPWIDKLLETGQTK
1q2xA           GLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLAVSSELIERKFGAALGGSLIPWIDKLLETGQTK
1pu2A           GLFEKDLVEWISVATYQAASGAGAKNMRELLSQMGLLAVSSELIERKFGAALGGSLIPWIDKLLETGQTK
1brmC           GLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYRSGELPVDNFGVPLAGSLIPWID--------K
1brmB           GLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYRSGELPVDNFGVPLAGSLIPWID---------
1brmA           GLFANDLVDWVSVATYQAASGGGARHMRELLTQMGHLYRSGELPVDNFGVPLAGSLIPWID---------
2g17A           PLIDGGLLDLTVINATSGVSGAGRK---------------------------------------------
1vknA           PALKHNLVETILVDAKSGVSGAGKEKVDYLFSE-------------------------------------
3dr3A           PLIDADLLDLPVINATSGVSGAGRK---------------------------------------------
1vknC           PALKHNLVETILVDAKSGVSGA--EKVDYLFSE-------------------------------------
1vknD           PALKHNLVDPETI-LVDAKSGVSGEKVDYLFSE-------------------------------------
1xygA           PLANLIKHENIIIDAKSGVSGAGRGAKENLYSEIAEGISSYGVTRHRH--------VPEIEQGLSD----
2cvoD           PLAKLIKVSNIIIDAKSGVSGAGR----------------------------------------------
2cvoA           PLAKLIKVSNIIIDAKSGVSGAGR----------------------------------------------
3gpdR           VIHDHFGIVEGLMTTVHAITATQK----------------------------------------------


                         .         .         .         +         .         .         .:280
query           EEWKMMVETKKILDPAIKLSATCVRVPVFVGHSEAVNIEFENPITADEARDILRRSPGCLVIDKHEPGGY
2qz9B           EEMKMVWETQKIFDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQTDG---IELFRGADF
2qz9A           EEMKMVWETQKIFDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQTDG---IELFRGADF
2r00C           EEMKMVWETQKIFDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQTDG---IELFRGADF
2r00A           EEMKMVWETQKIFDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQTDG---IELFRGADF
2r00B           EEMKMVWETQKIFDPSIMVNPTCVRVPVFYGHAEAVHVETRAPIDAEQVMDMLEQTDG---IELFRGADF
2yv3A           EEMKVVWETHKIFDDTIRISATAVRVPTLRAHAEAVSVEFARPVTPEAAREVLKEAPGVEVVDEPEAKRY
2gz3C           XXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIY
2gz3B           XXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIY
2gz1A           XXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIY
2gyyB           XXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIY
2gyyA           XXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIY
2gyyD           XXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIY
2gyyC           XXXXXXXXXXXXXDDSIAVSATCVRIPVLSAHSESVYIETKEVAPIEEVKAAIAAFPGAVLEDDVAHQIY
2hjsA           IERRIFAEVQALLGERIPLNVTCIQAPVFFGDSLSVTLQCAEPVDLAAVTRVLDATKG---IEWVGEGDY
2ep5D           ELTKLKLENNQIIPANLDSTVTSIRVPTRVGHMGVINIVTNERINIEEIKKTLKNKQPIIVRDEEDRPQP
2ep5A           ELTKLKLENNQIIPANLDSTVTSIRVPTRVGHMGVINIVTNERINIEEIKKTLKNKQPIIVRDEEDRPQP
1ys4A           ESLKLLGTLKKVELANFKISASCNRVAVIDGHTESIFVKTKEGAEPEEIKEVDKFDP---LKDLNLP-TY
1mb4A           EEWKAGVEANKILDSPVPIDGTCVRIGAMRCHSQALTIKLKQNIPLDEIEEMIATHNDWVKVIPNETARE
1ta4A           EEWKGYAETNKILDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVDKEITLRE
1nwcA           EEWKGYAETNKILDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVDKEITLRE
1t4bA           EEWKGQAETNKILNTSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAHNPWAKVVDREITMRE
1gl3A           EEWKGQAETNKILNTSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAHNPWAKVVDREITMRE
1ps8A           EEWKGYAETNKILDNPIPVDGLCVKIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVDKEITLRE
1pr3A           EEWKGYAETNKILDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVDKEITLRE
1pquC           EEWKGYAETNKILDNPIPVDGLCVRIGALRCNSQAFTIKLKKDLPLEEIEQIIASHNEWVKVDKEITLRE
1pquA           EEWKGYAETNKILDNPIPVDGLCVRIGALRCNSQAFTIKLKKDLPLEEIEQIIASHNEWVKVDKEITLRE
1ozaA           EEWKGYAETNKILDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVDKEITLRE
1pqpA           EEWKGYAETNKILDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVDKEITLRE
1nx6A           EEWKGYAETNKILDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVDKEITLRE
1nwhA           EEWKGYAETNKILDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVDKEITLRE
1q2xA           DEWKGYAETNKILDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVDKEITLRE
1pu2A           EEWRGYAETNKILDNPIPVDGLCVRIGALRCHSQAFTIKLKKDLPLEEIEQIIASHNEWVKVDKEITLRE
1brmC           EEWKGQAETNKILNTSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAHNPWAKVVDREITMRE
1brmB           -EWKGQAETNKILNTSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAHNPWAKVVDREITMRE
1brmA           --WKGQAETNKILNTSIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAHNPWAKVVDREITMRE
2g17A           ----------------------------------------------------------------------
1vknA           ----------------------------------------------------------------------
3dr3A           ----------------------------------------------------------------------
1vknC           ----------------------------------------------------------------------
1vknD           ----------------------------------------------------------------------
1xygA           -----------VAQSKVTVSFTPHLMPMIRGMQSTIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEG-
2cvoD           ----------------------------------------------------------------------
2cvoA           ----------------------------------------------------------------------
3gpdR           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           VTPYEAAGEDATYISRIRTDPTVDNGLVLWCVSDNLRKGAALNAIQIAEVLINRKLIxxxxxxx
2qz9B           PTQVDAGGKDHVLVGRVRNDISHHSGINLWVVADNVRKGAATNAVQIAELLV------------
2qz9A           PTQVDAGGKDHVLVGRVRNDISHHSGINLWVVADNVRKGAATNAVQIAELLV------------
2r00C           PTQVDAGGKDHVLVGRVRNDISHHSGINLWVVADNVRKGAATNAVQIAELLV------------
2r00A           PTQVDAGGKDHVLVGRVRNDISHHSGINLWVVADNVRKGAATNAVQIAELLV------------
2r00B           PT--------HVLVGRVRNDISHHSGINLWVVADNVRKGAATNAVQIAELLV------------
2yv3A           PMPLTASGKWDVEVGRIRKSLAFENGLDFFVVGDQLLKGAALNAVQIAE---------------
2gz3C           PQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLV-------
2gz3B           PQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLV-------
2gz1A           PQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLV-------
2gyyB           PQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLV-------
2gyyA           PQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLV-------
2gyyD           PQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLV-------
2gyyC           PQAINAVGSRDTFVGRIRKDLDAEKGIHMWVVSDNLLKGAAWNSVQIAETLHERGLV-------
2hjsA           PTVVDALGQDETYVGRVRAGQADPCQVNLWIVSDNVRKGAALNAVLLGELLIKHYL--------
2ep5D           IIDVNAESGMAVTVGRIRHE---NNVLRLVVLGDNLVRGAAGITILTVEVM-------------
2ep5A           IIDVNAESGMAVTVGRIRHE---NNVLRLVVLGDNLVRGAAGITILTVEVM-------------
1ys4A           AKPIRNEGNGSIVVGRIRKDPIFD--VKYTALEHNTIRGAAGASVLNAEYFVKK----------
1mb4A           LTPAKVTGTLSVPVGRLRKMAMGDDFLNAFTVGDQLLWGAA-----------------------
1ta4A           LTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLV------------
1nwcA           LTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLV------------
1t4bA           LTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-----------------------
1gl3A           LTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-----------------------
1ps8A           LTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLV------------
1pr3A           LTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLV------------
1pquC           LTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLV------------
1pquA           LTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLV------------
1ozaA           LTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLV------------
1pqpA           LTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLV------------
1nx6A           LTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLV------------
1nwhA           LTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLV------------
1q2xA           LTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLV------------
1pu2A           LTPAKVTGTLSVPVGRLRKLAMGPEYLAAFTVGDQLLWGAAEPVRRILKQLV------------
1brmC           LTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-----------------------
1brmB           LTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-----------------------
1brmA           LTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAA-----------------------
2g17A           ----------------------------------------------------------------
1vknA           ----------------------------------------------------------------
3dr3A           ----------------------------------------------------------------
1vknC           ----------------------------------------------------------------
1vknD           ----------------------------------------------------------------
1xygA           VVPRTHNVRGSNYCHMSVFPDRIPGRAIIISVIDNLVKGASGQALQNLNIML------------
2cvoD           ----------------------------------------------------------------
2cvoA           ----------------------------------------------------------------
3gpdR           ----------------------------------------------------------------