[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE38106.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3i5aA.bssp"
#ERROR : Can't open dsspfile "3i5cB.bssp"
#ERROR : Can't open dsspfile "3i5cA.bssp"
#ERROR : Can't open dsspfile "3i5bB.bssp"
#ERROR : Can't open dsspfile "3i5bA.bssp"
#ERROR : Can't open dsspfile "3breB.bssp"
#ERROR : Can't open dsspfile "3breA.bssp"
#ERROR : Can't open dsspfile "3ignA.bssp"
#ERROR : Can't open dsspfile "1w25A.bssp"
#ERROR : Can't open dsspfile "2v0nA.bssp"
#ERROR : Can't open dsspfile "3iclA.bssp"
#ERROR : Can't open dsspfile "3iclB.bssp"
#ERROR : Can't open dsspfile "3ezuA.bssp"

## Summary of PDB Search
:494
    2e-31  50%  3i5aA  [x.x.x] RESPONSE REGULATOR/GGDEF DOMAIN PROTEIN
    3e-26  41%  3i5cB  [x.x.x] FUSION OF GENERAL CONTROL PROTEIN GCN4 AND WSPR
    3e-26  41%  3i5cA  [x.x.x] FUSION OF GENERAL CONTROL PROTEIN GCN4 AND WSPR
    3e-26  41%  3i5bB  [x.x.x] WSPR RESPONSE REGULATOR
    3e-26  41%  3i5bA  [x.x.x] WSPR RESPONSE REGULATOR
    3e-26  41%  3breB  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    3e-26  41%  3breA  [x.x.x] PROBABLE TWO-COMPONENT RESPONSE REGULATOR
    1e-20  40%  3ignA  [x.x.x] DIGUANYLATE CYCLASE
    5e-20  40%  1w25A  [c.23.1 - c.23.1 - d.58.29] STALKED-CELL DIFFERENTIATION
    5e-20  40%  2v0nA  [x.x.x] RESPONSE REGULATOR PLED
    3e-13  41%  3iclA  [x.x.x] EAL/GGDEF DOMAIN PROTEIN
    7e-11  45%  3iclB  [x.x.x] EAL/GGDEF DOMAIN PROTEIN
    2e-07  35%  3ezuA  [x.x.x] GGDEF DOMAIN PROTEIN
:494

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3i5aA           ----------------------------------------------------------------------
3i5cB           ----------------------------------------------------------------------
3i5cA           ----------------------------------------------------------------------
3i5bB           ----------------------------------------------------------------------
3i5bA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3ignA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
3iclA           ----------------------------------------------------------------------
3iclB           ----------------------------------------------------------------------
3ezuA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3i5aA           ----------------------------------------------------------------------
3i5cB           ----------------------------------------------------------------------
3i5cA           ----------------------------------------------------------------------
3i5bB           ----------------------------------------------------------------------
3i5bA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3ignA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
3iclA           ----------------------------------------------------------------------
3iclB           ----------------------------------------------------------------------
3ezuA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3i5aA           ----------------------------------------------------------------------
3i5cB           ----------------------------------------------------------------------
3i5cA           ----------------------------------------------------------------------
3i5bB           ----------------------------------------------------------------------
3i5bA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3ignA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
3iclA           ----------------------------------------------------------------------
3iclB           ----------------------------------------------------------------------
3ezuA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3i5aA           ----------------------------------------------------------------------
3i5cB           ----------------------------------------------------------------------
3i5cA           ----------------------------------------------------------------------
3i5bB           ----------------------------------------------------------------------
3i5bA           ----------------------------------------------------------------------
3breB           ----------------------------------------------------------------------
3breA           ----------------------------------------------------------------------
3ignA           ----------------------------------------------------------------------
1w25A           ----------------------------------------------------------------------
2v0nA           ----------------------------------------------------------------------
3iclA           ----------------------------------------------------------------------
3iclB           ----------------------------------------------------------------------
3ezuA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTTDSLTGLINRRKFDTLIEREWRRA
3i5aA           ----------------------------------------------SDGLTGLSNRRHFDEYLELEWRRA
3i5cB           ----------------------------------------------SDGLTGLSNRRHFDEYLEMEWXXX
3i5cA           ----------------------------------------------SDGLTGLSNRRHFDEYLEMEWXXX
3i5bB           ----------------------------------------------SDGLTGLSNRRHFDEYLEMEWXXX
3i5bA           ----------------------------------------------SDGLTGLSNRRHFDEYLEMEWXXX
3breB           ----------------------------------------------SDGLTGLSNRRHFDEYLEMEWXXX
3breA           ----------------------------------------------SDGLTGLSNRRHFDEYLEMEWXXX
3ignA           ---------------------------------------------STDRLTGLLNRGTWENLVDAEYERF
1w25A           ----------------------------------------------TDQLTGLHNRRYMTGQLDSLVKRA
2v0nA           ----------------------------------------------TDQLTGLHNRRYMTGQLDSLVKRA
3iclA           -----------------------------------------------DTVTGLPNRQLFCDRLLQALAAH
3iclB           ----------------------------------------------------------------------
3ezuA           -----------------------------------------------DALTGVTRAGFFKTVGSLAYA-A


                         .         .         .         .         *         .         .:420
query           LRMNTPIALLIIDADHFKAFNDGYGHQAGDQVLVGIALCIGDSVQRAGDCAARFGGEEFAVLLPGGSATA
3i5aA           TRDQAQLSLLMIDVDYFKAYNDNFGHLEGDEALRQVAKAIRNSCSRPSDLPARYGGEEFAMVLPNTSPGG
3i5cB           XXXXXXXXXXMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGG
3i5cA           XXXXXXXXXXMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGG
3i5bB           XXXXXXXXXXMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGG
3i5bA           XXXXXXXXXXMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGG
3breB           XXXXXXXXXXMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGG
3breA           XXXXXXXXXXMIDVDYFKSYNDTFGHVAGDEALRQVAGAIREGCSRSSDLAARYGGEEFAMVLPGTSPGG
3ignA           RRYGQATSL-VFDIDHFKPVNDTYGHLAGDEVIRHTADVTRNNI-RQSDSAGRYGGEEFGIILPETDAES
1w25A           TLGGDPVSALLIDIDFFKKINDTFGHDIGDEVLREFALRLASNV-RAIDLPCRYGGEEFVVIMPDTALAD
2v0nA           TLGGDPVSALLIDIDFFKKINDTFGHDIGDEVLREFALRLASNV-RAIDLPCRYGGEEFVVIMPDTALAD
3iclA           ERDGNPVVLLFLDVDNFKSINDSLGHLVGDRLLRATAERIRTAV-RDGDTVARIGGDKFTILLNGAKDT-
3iclB           -RDGNPVVLLFLDVDNFKSINDSLGHLVGDRLLRATAERIRTAV-RDGDTVARIGGDKFTILLNGAKDT-
3ezuA           QRSGSNVGILI-DLDYFKLVG-----QTGDRILQLVAETITSHLRRS-DVVGRYDGDEFVVYLSPVEPAS


                         .         .         +         .         .         .         .:490
query           AQGVAETIRNKVAHWSVGQGDVTVSIGVASMTPAPGQHWPVLFEXXXXXXXXXXXXGRNCCVVAASxxxx
3i5aA           ARLLAEKLRQSVAGMNIPHSSLTVSIGVATVTPQVGQH--------------------------------
3i5cB           ARLLAEKVRRTVESLQISHSHLTVSIGVSTLVPGGGQTFRVLIEMADQALYQAKNNGRN-----------
3i5cA           ARLLAEKVRRTVESLQISHSHLTVSIGVSTLVPGGGQTFRVLIEMADQALYQAKNNGRN-----------
3i5bB           ARLLAEKVRRTVESLQISHSHLTVSIGVSTLVPGGGQTFRVLIEMADQALYQAKNNGRN-----------
3i5bA           ARLLAEKVRRTVESLQISHSHLTVSIGVSTLVPGGGQTFRVLIEMADQALYQAKNNGRN-----------
3breB           ARLLAEKVRRTVESLQISHSHLTVSIGVSTLVPGGGQTFRVLIEMADQALYQAKNNGRN-----------
3breA           ARLLAEKVRRTVESLQISHSHLTVSIGVSTLVPGGGQTFRVLIEMADQALYQAKNNGRN-----------
3ignA           ARVICERIREAISTVSTSAGDIQYTVGIAQLTETP-----------------------------------
1w25A           ALRIAERIRMHVSPFTVAHGNVTISIGV-SATAGEGDTPEALLKRADEGVYQAKASGRNAVVGKAA----
2v0nA           ALRIAERIRMHVSPFTVAHGNVTISIGV-SATAGEGDTPEALLKRADEGVYQAKASGRNAVVGKAA----
3iclA           ----------------------------------------------------------------------
3iclB           ----------------------------------------------------------------------
3ezuA           LRTVAENLRRSIEEES-ARVPVTASIGVA-----------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxx
3i5aA           ----
3i5cB           ----
3i5cA           ----
3i5bB           ----
3i5bA           ----
3breB           ----
3breA           ----
3ignA           ----
1w25A           ----
2v0nA           ----
3iclA           ----
3iclB           ----
3ezuA           ----