[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE38168.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1efpB.bssp"
#ERROR : Can't open dsspfile "1efvB.bssp"
#ERROR : Can't open dsspfile "2a1uB.bssp"
#ERROR : Can't open dsspfile "1t9gS.bssp"
#ERROR : Can't open dsspfile "2a1tS.bssp"
#ERROR : Can't open dsspfile "1o94E.bssp"
#ERROR : Can't open dsspfile "1o94C.bssp"
#ERROR : Can't open dsspfile "1o96C.bssp"
#ERROR : Can't open dsspfile "1o96A.bssp"
#ERROR : Can't open dsspfile "3cluC.bssp"
#ERROR : Can't open dsspfile "3cltC.bssp"
#ERROR : Can't open dsspfile "3clrC.bssp"
#ERROR : Can't open dsspfile "1o97C.bssp"
#ERROR : Can't open dsspfile "1o96Q.bssp"

## Summary of PDB Search
:249
    8e-90  70%  1efpB  [c.26.2] PROTEIN (ELECTRON TRANSFER FLAVOPROTEIN)
    7e-62  51%  1efvB  [c.26.2] ELECTRON TRANSFER FLAVOPROTEIN
    4e-61  51%  2a1uB  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    3e-56  51%  1t9gS  [c.26.2] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    8e-56  50%  2a1tS  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    3e-20  30%  1o94E  [c.26.2] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    3e-20  30%  1o94C  [c.26.2] ELECTRON TRANSFER FLAVOPROTEIN BETA-SUBUNIT
    8e-19  30%  1o96C  [c.26.2] ELECTRON TRANSFERRING FLAVOPROTEIN BETA-SUBUNIT
    8e-19  30%  1o96A  [c.26.2] ELECTRON TRANSFERRING FLAVOPROTEIN BETA-SUBUNIT
    2e-17  29%  3cluC  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETA
    5e-17  30%  3cltC  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETA
    5e-17  30%  3clrC  [x.x.x] ELECTRON TRANSFER FLAVOPROTEIN SUBUNIT BETA
    9e-17  29%  1o97C  [c.26.2] ELECTRON TRANSFERRING FLAVOPROTEIN BETA-SUBUNIT
    5e-13  28%  1o96Q  [c.26.2] ELECTRON TRANSFERRING FLAVOPROTEIN BETA-SUBUNIT
:249

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKVLVPVKRVVDYNVKIRVKSDGSGVELTNVKMSMNPFDEIAVEEALRLKEAGKATEVVVVSIGPAQASE
1efpB           MKVLVPVKRLIDYNVKARVKSDGSGVDLANVKMSMNPFDEIAVEEAIRLKEKGQAEEIIAVSIGVKQAAE
1efvB           LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIXXXXXXXXXXXXXXXXXIAVSCGPAQCQE
2a1uB           LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIXXXXXXXXXXXXXXXXXIAVSCGPAQCQE
1t9gS           LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIXXXXXXXXXXXXXXXXXIAVSCGPAQCQE
2a1tS           LRVLVAVKRVIDYAVKIRVKPDRTGVVTDGVKHSMNPFCEIXXXXXXXXXXXXXXXXXIAVSCGPAQCQE
1o94E           MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXX
1o94C           MKILVAVKQTAALEEDFEIR-DGMDVDEDFMMYDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXX
1o96C           MKILVAVKQTAALEEDFEIR-DGMDVDEDFMMYDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXX
1o96A           MKILVAVKQTAALEEDFEIR-DGMDVDEDFMMYDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXX
3cluC           MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXX
3cltC           MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXX
3clrC           MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXX
1o97C           MKILVAVKQTAALEEDFEIREDGMDVDEDFMMYDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXX
1o96Q           MKILVAVKQTAALEEDFEIR-DGMDVDEDFMMYDLNEWDDFSLEEAMKIKXXXXXXXXXXXXXXXXXXXX


                         .         .         *         .         .         .         .:140
query           TLRTGLAMGADRGILVKAEGTVEPLAVAKILKAIADEEQPGLIILGKQAIDDDSNQTGQMLAALLGWAQA
1efpB           TLRTALAMGADRAILVVAQQDIEPXXXXXXXXXXXXXEGTELIIAGKQAIDNDMNATGQMLAAILGWAQA
1efvB           TIRTALAMGADRGIHVEVPPALGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQG
2a1uB           TIRTALAMGADRGIHVEVPPALGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQG
1t9gS           TIRTALAMGADRGIHVEVPPALGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQG
2a1tS           TIRTALAMGADRGIHVEVPPALGPLQVARVLAKLAEKEKVDLVLLGKQAIDDDCNQTGQMTAGFLDWPQG
1o94E           SLRKCLAKGXXXXXXXXXEGS-DAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHA
1o94C           SLRKCLAKGXXXXXXXXXEGS-DAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHA
1o96C           SLRKCLAKGXXXXXXXXXEGS-DAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHA
1o96A           SLRKCLAKGXXXXXXXXXEGS-DAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHA
3cluC           SLRKCLAKGXXXXXXXXXEGS-DAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHA
3cltC           SLRKCLAKGXXXXXXXXXEGS-DAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHA
3clrC           SLRKCLAKGXXXXXXXXXEGS-DAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHA
1o97C           SLRKCLAKGXXXXXXXXXEGS-DAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHA
1o96Q           SLRKCLAKGXXXXXXXXXEGS-DAIVVGRILTEVIKKEAPDMVFAGVQSSDQAYASTGISVASYLNWPHA


                         +         .         .         .         .         *         .:210
query           TFASKLEVEGSDFTVSREVDGGSQTVKLKGPAIVTTDLRLNEPRYASLPNIMKAKKKPIAEKTADQYGVD
1efpB           TFASKVEIEGAKAKVTREVDGGLQTIAVSLPAVVTADLRLNEPRYASLPNIMKAKKKPLDEKTAADYGVD
1efvB           TFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNXXXXXXXXXXXXXPGDLGVD
2a1uB           TFASQVTLEGDKLKVERAIDGGLETLRLKLPAVVTADLRLNEPRYATLPNXXXXXXXXXXXXXPGDLGVD
1t9gS           TFASQVTLEGDKLKVEREIDGGLETLRLKLPAVVTADLRLNEPRYATLPNXXXXXXXXXXXXXPGDLGVD
2a1tS           TFASQVTLEGDKLKVERAIDGGLETLRLKLPAVVTADLRLNEPRYATLPNXXXXXXXXXXXXXPGDLGVD
1o94E           AVVADLQYKPGDAVIRRELEGGMQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADIGL-
1o94C           AVVADLQYKPGDAVIRRELEGGMQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADIGL-
1o96C           AVVADLQYKPGDAVIRRELEGGMQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADIGL-
1o96A           AVVADLQYKPGDAVIRRELEGGMQEVEINCPAVLTIQLGINKPRYASLRGIKQAATKPIEEVSLADIGL-
3cluC           AVVADLQYKPGDAVIRRELEGGMQEVEINCPAVLTIQLGINKPRYASKP---------------------
3cltC           AVVADLQYKPGDAVIRRELEGGMQEVEINCPAVLTIQLGINKPRYAS--------TKPIEEVSLADIGL-
3clrC           AVVADLQYKPGDAVIRRELEGGMQEVEINCPAVLTIQLGINKPRYAS--------TKPIEEVSLADIGL-
1o97C           AVVADLQYKPGDAVIRRELEGGMQEVEINCPAVLTIQLGINKPRYAS-----------------------
1o96Q           AVVADLQYKPGDAVIRRELEGGMQEVEINCPAVLTIQLGINKP---------------------------


                         .         .         .         +         .         .         .:280
query           LAPRLEVLKTVEPSGRKAGVKVKDVAELVSKLKxxxxxx
1efpB           VAPRLEVVSVREPEGRKAGIKVGSVDELVGKL-------
1efvB           LTSKLSVISVEDPPQRTAGVKVETTEDLVAKLK------
2a1uB           LTSKLSVISVEDPPQRTAGVKVETTEDLVAKLK------
1t9gS           LTSKLSVISVEDP--------------------------
2a1tS           LTSKLSVISVEDP---------PTTEDLVAKLK------
1o94E           ---------------------------------------
1o94C           ---------------------------------------
1o96C           ---------------------------------------
1o96A           ---------------------------------------
3cluC           ---------------------------------------
3cltC           ---------------------------------------
3clrC           ---------------------------------------
1o97C           ---------------------------------------
1o96Q           ---------------------------------------