[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE38181.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "1ii8B.bssp"
#ERROR : Can't open dsspfile "1f2uD.bssp"
#ERROR : Can't open dsspfile "1f2uB.bssp"
#ERROR : Can't open dsspfile "1f2tB.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1us8B.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"

## Summary of PDB Search
:219
    5e-33  33%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    4e-32  37%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    1e-30  39%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-30  39%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-25  33%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    1e-24  40%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-24  33%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-24  33%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    2e-24  33%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    8e-23  31%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    3e-22  32%  2oukB  [x.x.x] PROTEIN ARTP
    3e-22  32%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    6e-20  34%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    3e-19  32%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    3e-19  32%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    3e-19  33%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    9e-19  35%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    3e-18  28%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    3e-18  28%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-18  28%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-18  28%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-18  28%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-18  28%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-17  29%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    2e-17  29%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    2e-17  27%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    2e-17  27%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    4e-17  29%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    7e-16  28%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    7e-16  28%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-15  28%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-15  28%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-15  28%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-15  29%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-15  29%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-15  28%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-15  31%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-15  35%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    3e-15  31%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    3e-15  31%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    4e-14  34%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    4e-14  34%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    4e-13  30%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    5e-13  36%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    7e-13  27%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    9e-13  24%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-12  30%  1ji0A  [c.37.1] ABC TRANSPORTER
    4e-12  30%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    4e-12  30%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    6e-12  28%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-12  28%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-12  30%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    8e-12  33%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    2e-11  28%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    2e-11  36%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-11  30%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    5e-11  29%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-11  30%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    7e-11  31%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    9e-11  29%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-10  23%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-10  27%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    3e-10  23%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    6e-10  22%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    7e-10  28%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-09  28%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-08  29%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-08  33%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-08  29%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    9e-08  30%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-08  29%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-08  26%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-07  28%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-07  26%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-07  26%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-07  26%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-07  40%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    2e-07  40%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    2e-07  31%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-07  31%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-07  31%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  24%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-07  30%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-07  25%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-07  34%  1yqtA  [x.x.x] RNASE L INHIBITOR
    8e-07  27%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    1e-06  27%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    1e-06  24%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-06  24%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-06  27%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    3e-06  25%  2d2eA  [x.x.x] SUFC PROTEIN
    4e-06  33%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    8e-06  28%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-06  28%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-06  28%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-06  28%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  32%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    1e-05  32%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    1e-05  25%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  25%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-05  24%  2d2fA  [x.x.x] SUFC PROTEIN
    3e-05  39%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    3e-05  39%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    3e-05  39%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    7e-05  27%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    7e-05  27%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    9e-05  36%  1ii8B  [c.37.1] RAD50 ABC-ATPASE
    9e-05  36%  1f2uD  [c.37.1] RAD50 ABC-ATPASE
    9e-05  36%  1f2uB  [c.37.1] RAD50 ABC-ATPASE
    9e-05  36%  1f2tB  [c.37.1] RAD50 ABC-ATPASE
    3e-04  22%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    4e-04  34%  1us8B  [c.37.1] DNA DOUBLE-STRAND BREAK REPAIR RAD50 ATPASE
    4e-04  28%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-04  28%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    8e-04  28%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    8e-04  28%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    8e-04  28%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    8e-04  28%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVRFENVGLRYGLGPEILRDLNFAIPAHSFQFLTGPSGAGKTXXXXXXXXXXXPTRGLVNLFGNDVSLLT
3dhwC           MIKLSNITKVFHQGTRTIQALNLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQELTTLS
2pcjA           -------------GYEILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEVDYTN
1l2tB           MIKLKNVTKTYKMGEEILKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLD
1l2tA           MIKLKNVTKTYKMGEEILKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKTNDLD
1b0uA           ---------RYG-GHEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQNINLVR
1f3oA           -IKLKNVTKTYK-GEEILKNVNLNIKEGEFVSI-GPSGSGKSTLNIIGCLDK-PTEGEVYIDNIKTNDLD
2yyzA           --------------------VSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSG--EIYFDDVLV--
2it1B           -IKLENIVKKFG-NFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELP
2it1A           -IKLENIVKKFG-NFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEKDVTELP
1g291           -----------------VREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLVADPE
2oukB           ---------------EVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDXXXXXXNLKAKDTNL--
2oljA           ---------------EVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLEDXXXXXXNLKAKDTNL--
2d62A           -VKLINIWKRFG-DVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLRIAGLEE-PTRGQIYIEDNLVADPE
1oxvA           --------------------------------ILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNG
1oxsC           --------------------------------ILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNG
3d31A           -----------------LDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGKDVT---
2onkA           --------------------------------LLGPTGAGKSVFLELIAGIVKPDRGEVRLNGADITPLP
1q12A           -VQLQNVTKAWG-EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSG--DLFIGEKRM--
3fh6A           -VQLQNVTKAWG-EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSG--DLFIGEKRM--
2awoA           -VQLQNVTKAWG-EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSG--DLFIGEKRM--
2awnB           -VQLQNVTKAWG-EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSG--DLFIGEKRM--
2r6gB           -VQLQNVTKAWG-EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSG--DLFIGEKRM--
2r6gA           -VQLQNVTKAWG-EVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSG--DLFIGEKRM--
1z47B           -IEFVGVEKIYPGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVT---
1z47A           -IEFVGVEKIYPGGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGKRVT---
3fvqB           ----------------VLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGK--TIFS
3fvqA           ----------------VLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGK--TIFS
3gfoA           ILKVEELNYNYSDGTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRI-LFDNKPIDYS
1mt0A           -ITFRNIRFRYKPSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA-
2ff7A           -ITFRNIRFRYKPSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA-
2fgkA           -ITFRNIRFRYKPSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA-
2ffbA           -ITFRNIRFRYKPSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA-
3b5jA           -ITFRNIRFRYKPSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA-
1xefA           -ITFRNIRFRYKPSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA-
2ffaA           -ITFRNIRFRYKPSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALA-
2awoC           ----------------VSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSG--DLFIGEKRM--
2awnC           ----------------VSKDINLDIHEGEFVVFVGPSGCGKSTLL----------RMIAGL---------
1v43A           -VKLENLTKRFGNFTAVNK-LNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLP
1mv5D           MLSARHVDFAYDDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNIS
1mv5A           MLSARHVDFAYDDSEQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPIDNIS
3g60A           -VQFSGVVFNYPTRPSILQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLN
3g5uA           -VQFSGVVFNYPTRPSILQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLN
2ghiA           -IEFSDVNFSYPTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGKNVNKYN
2ihyA           LIQLDQIGRKQG--KTILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGK-----P
1oxxK           --------------------------------ILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNG
1vplA           -----------------------------------PNGAGKTTTLRIISTLIKPSSGIVTVFGKNVV---
1ji0A           -----------------IKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDI---T
2ixfC           LVKFQDVSFAYPNHPQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEP---LV
2ixfA           LVKFQDVSFAYPNHPQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEP---LV
2yz2B           ------------LEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGE------
2yz2A           ------------LEKKALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGE------
2ixfD           LVKFQDVSFAYPNHPQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEP---LV
2hydA           ----------------ILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNI----
2ghiC           -IEFSDVNFSYPTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGKNVNKYN
2ihyB           LIQLDQIGRKQG--KTILKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKPGKVGY
2ghiB           -IEFSDVNFSYPTNHRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGKNVNKYN
2ixeA           LVKFQDVSFAYPNHPQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEP---LV
2ghiD           -IEFSDVNFSYH---RTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYD-AEGDIKIGGKNVNKYN
1pf4A           -----------------LSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVR---
2ixeD           LVKFQDVSFAYPNHPQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPLVQYD
1g6hA           ILRTENI-VKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDIT--N
1jj7A           LVQFQDVSFAYPNRPDVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKP---LP
1g9xA           ILRTENI-VKYFGEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDIT--N
1gajA           ILRTENI-VKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDIT--N
1xmiB           ---FSNFSL---LGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------
2ixgA           LVKFQDVSFAYPNHPQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEP---LV
2nq2C           ----ENLGFYYQAENFLFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVY--------
3bk7A           --------------------------------IVGPNGIGKTTFVKMLAGVEEPTEGKVEW---DLTVAY
2nq2D           ----ENLGFYY----QAFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVY--------
1xmiD           ---FSNFSL---LGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------
2pzgB           -------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------
2pzfA           -VVMENVTAFWG-GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2bbsA           -------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------
1xmiE           ---FSNFSL---LGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
1xmiC           ---FSNFSL---LGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
1xmiA           ---FSNFSL---LGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2pzgA           -------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------
2pzeB           -------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------
2pzeA           -------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------
2bbtA           -------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2bboA           -----------GLGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSG-------
2pzfB           -------------GTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
1yqtA           ----------------------------------------------------------------------
3b60A           -LEFRNVTFTYGREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYT
1z2rA           ---FRNVTFTYGREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYT
2bbtB           ----------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2bbsB           ----------------VLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIKHSGR-ISFCS
2pjzA           MIQLKNVGITLGKGYESLENINLEVNGEKVIIL-GPNGSGKTTLLRAIS-------GLLPYSGN--IFIN
2d2eA           -------------GETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTRGEILLDGENILELS
2cbzA           ----------------------------------------------------------------------
1xf9D           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------
1xf9C           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------
1xf9B           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------
1xf9A           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSG-------
1xfaA           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
1r10A           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
1r0zD           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
1r0zC           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
1r0zB           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
1r0zA           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
1r0xD           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
1r0xC           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
1r0xB           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
1r0xA           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
1r0wC           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
1r0wB           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
1r0wA           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
1q3hD           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
1q3hC           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
1q3hB           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
1q3hA           ------------VGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGR-VSFCS
2d2fA           -------------GETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPEYTRGEILLDGENILELS
2ix8A           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
2zu0C           ----------------ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDVTGGTVEFKGKDLLALS
2d3wA           ----------------ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDVTGGTVEFKGKDLLALS
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
1sgwA           --------LSVGYDKPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITKV-
1us8B           ----------------------------------------------------------------------
2d3wD           ----------------ILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREDVTGGTVEFKGKDLLALS
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KDEVSALRQRIGIVLQDFRLLDHMTTYENVALPFRVSGRDESSYRKEVIDLLKWVGLGERMDALPPVLSG
3dhwC           ESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPSNLSG
2pcjA           EKELSLLRNRLGFVFQFHYLIPELTALENVIVPMLKMGKPKKEAKERGEYLLSELGLGDKLSRKPYELSG
1l2tB           DDELTKIRRKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSRRKRALECLKMAELEERFNHKPNQLSG
1l2tA           DDELTKIRRKIGFVFQQFNLIPLLTALENVELPLIFKYRGAMSRRKRALECLKMAELEERFNHKPNQLSG
1b0uA           KNQLRLLRTRLTMVFQHFNLWSHMTVLENVMAPIQVLGLSKHDARERALKYLAKVGIDERAQGKYPVLSG
1f3oA           DDELTKIRRKIGFVFQQFNLIPLLTALENVELPFKYRGASGEERRKRALECLK-AELEERFNHKPNQLSG
2yyzA           -NDIPPKYREVGMVFQNYALYPHMTVFENIAFPLRARRISKDEVEKRVVEIARKLLIDNLLDRKPTQLSG
2it1B           PKD-----RNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQLSG
2it1A           PKD-----RNVGLVFQNWALYPHMTVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPWQLSG
1g291           KGIFVPPKDRIAMVFQSYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELLGLTELLNRKPRELSG
2oukB           ----NKVREEVGMVFQRFNLFPHMTVLNNITLPMKVRKWPREKAEAKAMELLDKVGLKDKAHAYPDSLSG
2oljA           ----NKVREEVGMVFQRFNLFPHMTVLNNITLPMKVRKWPREKAEAKAMELLDKVGLKDKAHAYPDSLSG
2d62A           KGVFVPPKERDVAVFQSYALYPH-TVYDNIAFPLKLRKVPKQEIDKRVREVAE-LGLTELLNRKPRELSG
1oxvA           KLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSG
1oxsC           KLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSG
3d31A           --DLSPEKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDP---KRVLDTARDLKIEHLLDRNPLTLSG
2onkA           PE-----RRGIGFVPQDYALFPHLSVYRNIA--YGLXXXXXXXXXXXXXXMAEKLGIAHLLDRKPARLSG
1q12A           -NDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSG
3fh6A           -NDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSG
2awoA           -NDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSG
2awnB           -NDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSG
2r6gB           -NDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSG
2r6gA           -NDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSG
1z47B           --DLPPQKRNVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRFMRLESYANRFPHELSG
1z47A           --DLPPQKRNVGLVFQNYALFQHMTVYDNVSFGLREKRVPKDEMDARVRELLRFMRLESYANRFPHELSG
3fvqB           KNTNLPVRERLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSG
3fvqA           KNTNLPVRERLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRIEAMLELTGISELAGRYPHELSG
3gfoA           RKGIMKLRESIGIVFQDDNQLFSASVYQDVSFGAVNMKLPEDEIRKRVDNALKRTGIEHLKDKPTHCLSF
1mt0A           --DPNWLRRQVGVVLQDNVLLNR-SIIDNISLANPGMSVEKVIYAAKLAGAHDFIGYNTIVGEQGAGLSG
2ff7A           --DPNWLRRQVGVVLQDNVLLNR-SIIDNISLANPGMSVEKVIYAAKLAGAHDFIGYNTIVGEQGAGLSG
2fgkA           --DPNWLRRQVGVVLQDNVLLNR-SIIDNISLANPGMSVEKVIYAAKLAGAHDFIGYNTIVGEQGAGLSG
2ffbA           --DPNWLRRQVGVVLQDNVLLNR-SIIDNISLANPGMSVEKVIYAAKLAGAHDFIGYNTIVGEQGAGLSG
3b5jA           --DPNWLRRQVGVVLQDNVLLNR-SIIDNISLANPGMSVEKVIYAAKLAGAHDFIGYNTIVGEQGAGLSG
1xefA           --DPNWLRRQVGVVLQDNVLLNR-SIIDNISLANPGMSVEKVIYAAKLAGAHDFIGYNTIVGEQGAGLSG
2ffaA           --DPNWLRRQVGVVLQDNVLLNR-SIIDNISLANPGMSVEKVIYAAKLAGAHDFIGYNTIVGEQGAGLSG
2awoC           -NDTPPAERGVGMVA----LYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSG
2awnC           ---------GVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSG
1v43A           PKD-----RNISMVFQ------HMTVYENIAFPLKKFPKDEIDKRRWAAELLQ---IEELLNRYPAQLSG
1mv5D           LEN---WRSQIGFVSQDSAIMAG-TIRENLTYGLEGDYTDEDLW--QVLDLAFARSFVENMDQLNTEISG
1mv5A           LEN---WRSQIGFVSQDSAIMAG-TIRENLTYGLEGDYTDEDLW--QVLDLAFARSFVENMDQLNTEISG
3g60A           ---VQWLRAQLGIVSQEPILFD-CSIAENIAYG------DNSSY-EEIVRAAKEANIHQFIDSLPDKLSG
3g5uA           ---VQWLRAQLGIVSQEPILFD-CSIAENIAYG------DNSSY-EEIVRAAKEANIHQFIDSLPDKLSG
2ghiA           RNSIRSI---IGIVPQDTILFNETIKYN--ILYGKLDATDE-----EVIKATKSAQLYDFIEALPKKLSG
2ihyA           GYSAETVRQHIGFV--SHSLLEKFQEGERV-IDVVISGAIDDEIRNEAHQLLKLVGSAKAQQYI-GYLST
1oxxK           KLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSG
1vplA           -EEPHEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATEIAGLGEKIKDRVSTYSK
1ji0A           NKPAHVINRGIALVPEGRRIFPELTVYENLGAYNR---KDKEGIKRD----LEWIRLKERLKQLGGTLSG
2ixfC           QYDHHYLHTQVAAVGQE-PLLFGRSFRENIAY-----GLTRTPTMEEITAVAMESGAHDFISGFPQQLSG
2ixfA           QYDHHYLHTQVAAVGQE-PLLFGRSFRENIAY-----GLTRTPTMEEITAVAMESGAHDFISGFPQQLSG
2yz2B           RKKGYEIRRNIGIAFQDQFFAERVFDEVAFAVKNFYPDRDPVPLVKKAME---FVGLDSFKDRVPFFLSG
2yz2A           RKKGYEIRRNIGIAFQDQFFAERVFDEVAFAVKNFYPDRDPVPLVKKAME---FVGLDSFKDRVPFFLSG
2ixfD           QYDHHYLHTQVAAVGQ---LLFGRSFRENIAY-----GLTRTPTMEEITAVAMESGAHDFISGFPQQLSG
2hydA           KDFLTSLRNQIGLVQQD-NILFSDTVKENILLG-RPTATDE-----EVVEAAKMANAHDFIMNLPQKLSG
2ghiC           RNSIRSI---IGIVPQDTILFNETIKY-NI-----LYGKLDAT--EEVIKATKSAQLYDFIEALPKIVGG
2ihyB           SAE--TVRQHIGFV--SHSLLEKFQEGERV-IDVVISGAFKSEIRNEAHQLLKLVGSAKAQQYI-GYLST
2ghiB           RNSIRSI---IGIVPQDTILFNETIKYN--ILYGKLDATDE-----EVIKATKSAQLYDFIEALPKKLSG
2ixeA           QYDHHYLHTQVAAVGQE-PLLFGRSFRENIAY-----GLTRTPTMEEITAVAMESGAHDFISGFPQQLSG
2ghiD           RNSIRSI---IGIVPQDTILFNETIKYN--ILYGKLDATDE-----EVIKATKSAQLYDFIEALPKVLSG
1pf4A           DYKLTNLRRHFALVSQNVHLFND-TIANNIAYAA------EGEYTREQIEAMEFIGLDTVIGENGTSLSG
2ixeD           HHYLHTQVAAVGPLLRSFR--------ENIAY-----GLTRTPTMEEITAVAMESGAHDFISGFPQQLSG
1g6hA           KEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESEEEMVEKAFKILEFLKLSHLYDRKAGELSG
1jj7A           QYEHRYLHRQVAAVGQEPQVFGR-SLQENIAYGLEITAAAVKSGAHSFISGLPQ-GYDTEVDEAGSQLSG
1g9xA           KEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESEEEMVEKAFKILEFLKLSHLYDRKAGELSG
1gajA           KEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEINPGESEEEMVEKAFKILEFLKLSHLYDRKAGELSG
1xmiB           ---------RISFCSQ-FSWIMPGTIKENI-----IAGVSYDEYRYRSV--IKACQLEEDISKIVLTLSG
2ixgA           QYDHHYLHTQVAAVGQE-PLLFGRSFRENIAY-----GLTRTPTMEEITAVAMESGAHDFISGFPQQLAV
2nq2C           --------QSIGFVPQDIVLMGRSTHINTFAKP----KSHDYQVAMQALDYLNLTHLAKREFTS---LSG
3bk7A           KPQYIKAEYE-GTVYELLSKID--------------SSKLNSNFYKT--ELLKPLGIIDLYDRNVEDLSG
2nq2D           --------QSIGFVPQDIVLMGRSTHINTFAKP----KSHDYQVAMQALDYLNLTHLAKREFTS---LSG
1xmiD           ---------RISFCSQ-FSWIMPGTIKENI-----IAGVSYDEYRYRSVDISKFIVLGEI------TLSG
2pzgB           ---------RISFCSQ-FSWIMPGTIKENII--FGVS-YDEYRYRSVICQLEEDISKFAEKDVLGITLSG
2pzfA           QFSPGTIKENIGVSYDEYR-------YRSVIKACQLE-EDISKFAEKDNIVLGEGGI---------TLSG
2bbsA           ---------RISFCSQNSWIMPG-TIKENI---IGVS-YDEYRYRSVIEDISKF---AEKDNIVLITLSG
1xmiE           QFSPGTIKENIGVSYDEYR-------YRSVIKACQLE-EDISKFAEKDNIVLGEGGI---------TLSG
1xmiC           QFSPGTIKENIGVSYDEYR-------YRSVIKACQLE-EDISKFAEKDNIVLGEGGI---------TLSG
1xmiA           QFSPGTIKENIGVSYDEYR-------YRSVIKACQLE-EDISKFAEKDNIVLGEGGI---------TLSG
2ix3A           ---------------------------------------------KEAIDKLIEFGFTDEMIAMPSALSG
2iwhB           ---------------------------------------------KEAIDKLIEFGFTDEMIAMPSALSG
2pzgA           ---------RISFCSQ-FSWIMPGTIKENII--FGVS-YDEYRYRSVIEDISKFIVLGEG----GITLSG
2pzeB           ---------RISFCSQ-FSWIMPGTIKENII--FGVS-YDEYRYRSVIEDISKFIVLGEG----GITLSG
2pzeA           ---------RISFCSQ-FSWIMPGTIKENII--FGVS-YDEYRYRSVIEDISKFIVLGEG----GITLSG
2bbtA           QNSPGTIKENIGVSYDEYR-------YRSVIKACQLE-EDISKFAEKDNIVLGGI-----------TLSG
2bboA           ---------RISFCSQ-FSWIMPGTIKENII--FGVS-YDEYRYRSVIEDISKFIVLGEG----GITLSE
2pzfB           QFSPGTIKENIGVSYDEYR-------YRSVIKACQLE-EDISKFAEKDNIVLGEGGI---------TLSG
1yqtA           -------------------------------------------------ELLKPLGIIDLYDREVNELSG
3b60A           ---LASLRNQVALVSQNVHLFND-TVANNIAY-----ARTEEYSREQIEEAARMAGLDTIIGENGVLLSX
1z2rA           ---LASLRNQVALVSQNVHLFND-TVANNIAY-----ARTEEYSREQIEEAARMAGLDTIIGENGVLLSX
2bbtB           QNSPGTIKENIGVSYDEYR-------YRSVIKACQLEEDISKFAEKDNI-------------VLGITLSG
2bbsB           QNSPGTIKENIGVSYDEYR-------YRSVIKACQLE-EDISKFAEKDNIVLGGI-----------TLSG
2pjzA           GMEVRKIRNYIRYSTNLPEAYEIGVTVNDIVYLYELKGLDRDLF----LEMLKALKLGEEILRRKLYLSA
2d2eA           PDE----RARKGLFLAQYPVVPGVTIANFLRLALQAKGREVGTKVKKALELLDW-----DESYLSRYLNE
2cbzA           -------------------------------------------------------------------LSG
1xf9D           ---------RVSFCSQ-FSWIMPGTIKENI-----ISGVSYDEYRKSVVDITKFAEQDNTVLGEGGVLSG
1xf9C           ---------RVSFCSQ-FSWIMPGTIKENI-----ISGVSYDEYRKSVVDITKFAEQDNTVLGEGGVLSG
1xf9B           ---------RVSFCSQ-FSWIMPGTIKENI-----ISGVSYDEYRKSVVDITKFAEQDNTVLGEGGVLSG
1xf9A           ---------RVSFCSQ-FSWIMPGTIKENI-----ISGVSYDEYRKSVVDITKFAEQDNTVLGEGGVLSG
1xfaA           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
2r6fB           ---------------------------------------------KRKLETLYDVGLGYKLGQPATTLSG
2r6fA           ---------------------------------------------KRKLETLYDVGLGYKLGQPATTLSG
1r10A           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
1r0zD           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
1r0zC           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
1r0zB           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
1r0zA           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
1r0xD           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
1r0xC           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
1r0xB           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
1r0xA           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
1r0wC           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
1r0wB           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
1r0wA           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
1q3hD           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
1q3hC           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
1q3hB           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
1q3hA           QFSPGTIKENIGVSYDEYR-------YKSVVKACQLQ-QDITKFAEQDNTVLGEGGV---------TLSG
2d2fA           PDE----RARKGLFLPGVTIANFLRLALQAKLGREVGVAEFWTKVKKALELLDW-DESYLSRYLNEGFSG
2ix8A           -------------------------------------------------------------DEIAPILSG
2iw3B           -------------------------------------------------------------DEIAPILSG
2iw3A           -------------------------------------------------------------DEIAPILSG
2zu0C           PED----RAGEGI----FMAFQYPVEIPGVSNQFQTALNAVRSYRQETLDRFDFQDLMEEKIALLKMFSG
2d3wA           PED----RAGEGI----FMAFQYPVEIPGVSNQFQTALNAVRSYRQETLDRFDFQDLMEEKIALLKMFSG
1ii8B           -------------------------------------------------------------------LSG
1f2uD           -------------------------------------------------------------------LSG
1f2uB           -------------------------------------------------------------------LSG
1f2tB           -------------------------------------------------------------------LSG
1sgwA           KGKIFFLPEEI-IVPRKISVEDYLKAVASL-YGVKVNKNEDALESVEVLDLKKKLG----------ELSQ
1us8B           -------------------------------------------------------------------LRG
2d3wD           PED----RAGEGI----FMAFQYPVEIPGVSNQFQTALNAVRSYRQETLDRFDFQDLMEEKIALLKMFSG
2vf8B           -----------------------------------------------------------------PTLSP
2vf8A           -----------------------------------------------------------------PTLSP
2vf7C           -----------------------------------------------------------------PTLSP
2vf7B           -----------------------------------------------------------------PTLSP
2vf7A           -----------------------------------------------------------------PTLSP


                         +         .         .         .         .         *         .:210
query           GEKQRAAIARAVIGRPQLLLADEPTGNVDPTLGRRLLRLFVELNKSGTAVVIATHDINLMDQYEARRMVL
3dhwC           GQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRGLTILLITHEMDVVKRICDCVAVI
2pcjA           GEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHERELAE---------
1l2tB           GQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEDGKTVVVVTHDINV-----------
1l2tA           GQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEDGKTVVVVTHDINV-----------
1b0uA           GQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFL
1f3oA           GQQQRVAIARALANNPPIILADEPTGALDSKTGEK-IQLLKKLNEDGKTVVVVTHDINV-----------
2yyzA           GQQQRVALARALVKQPKVLLFDEPLSNLDANL-RMIMRAEIKQQELGITSVYVTHDQAEAMTMASRIAVF
2it1B           GQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKEGITTVYVTHD--------------
2it1A           GQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKEGITTVYVTHD--------------
1g291           GQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQGVTTIYVTHD--------------
2oukB           GQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRVLFM
2oljA           GQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDRVLFM
2d62A           GQRQRVALGRAIIRRPKVFL-DEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTH-----DQVEATRIAV
1oxvA           GQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVSRLGVTLLVVSHD--------------
1oxsC           GQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVSRLGVTLLVVSHD--------------
3d31A           GEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLITH-----DQTEARIM--
2onkA           GERQRVALARALVIQPRLLLLDEPLSAVDKTKGVLMEELRFVQREFDVPILHVTHDL-------------
1q12A           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHD--------------
3fh6A           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHD--------------
2awoA           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHD--------------
2awnB           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHD--------------
2r6gB           GQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHD--------------
2r6gA           GQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHD--------------
1z47B           GXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQI-RRELRTFVRQDEMGVTSVFVTHDQEEALEVADRVLVL
1z47A           GXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQI-RRELRTFVRQDEMGVTSVFVTHDQEEALEVADRVLVL
3fvqB           GXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREMIAALRANGKSAVFVSHDREEALQYADRIAVM
3fvqA           GXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREMIAALRANGKSAVFVSHDREEALQYADRIAVM
3gfoA           GQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQK-------------------------
1mt0A           GQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIA-HRLSTVKNAD-RIIVM
2ff7A           GQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIA-HRLSTVKNAD-RIIVM
2fgkA           GQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIA-HRLSTVKNAD-RIIVM
2ffbA           GQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICKGRTVIIIA-HRLSTVKNAD-RIIVM
3b5jA           GQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIA-HRLSTVKNAD-RIIVM
1xefA           GQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIA-----------------
2ffaA           GQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICKGRTVIIIA-----------------
2awoC           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHD--------------
2awnC           GQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHD--------------
1v43A           GXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKL-RVAMRAEIKQQKLKVTTIYVTH-----DQVEAMTMVM
1mv5D           GQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVD---------
1mv5A           GQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLMKGRTTLVIAHRLSTIVD---------
3g60A           GQKQRIAIARALVRQPHILLLDEATSALD-TESEKVVQEALDKAREGRTCIVIAHRLS------------
3g5uA           GQKQRIAIARALVRQPHILLLDEATSALD-TESEKVVQEALDKAREGRTCIVIAHRLS------------
2ghiA           GERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIA-HRLSTISSAES-IILL
2ihyA           GEKQR-VIARA-LGQPQVLILDEPAAGLD-----------------------------------------
1oxxK           XXXXXXXXXXXXXKDPSLLLLDEPFSNLDARMRDSARALVKEVSRLGVTLLVVSHD--------------
1vplA           GMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFLCDRIALI
1ji0A           GEQQ-LAIGRA-LSRPKLL--DEPSLGLAPILVSEVFEVIQKINQEGTTILL------------------
2ixfC           GQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEASRTVLLITHQLSLAER--------
2ixfA           GQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEASRTVLLITHQLSLAER--------
2yz2B           GEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDRVVVL
2yz2A           GEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDRVVVL
2ixfD           GQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEASRTVLLITHQLSLAER--------
2hydA           GQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVA-----------------
2ghiC           GERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLRKNRTLIIIA-HRLSTISSAES-IILL
2ihyB           GEKQR-VIARA-LGQPQVLILDEPAAGLD-----------------------------------------
2ghiB           GERQRIAIARCLLKDPKIVIFDEATS--DSKTEYLFQKAVEDLRKNRTLIIIAHRTISSAESI----ILL
2ixeA           GQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEASRTVLLITQQLSLAER--------
2ghiD           GERQRIAIARCLLKDPKIVIFDD----------SKTEYLFQKAVEDNRTLIIIAHRLSTISSAES-IILL
1pf4A           GQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQKNKTVLVIA-HRLSTIEQAD-EILVV
2ixeD           GQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEASRTVLLITQQLSLAER--------
1g6hA           GQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVM
1jj7A           GQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESERYSRSVLLITQHLSLVEQ--------
1g9xA           GQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVM
1gajA           GQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYVM
1xmiB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
2ixgA           GQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEASRTVLLITQQLSLAER--------
2nq2C           GQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSNMTVVFTTHQPNQVVAIANKTLLL
3bk7A           GELQRVAIAATLLRDADIYLLDEPSAYLDRLAVSRAIRHLMEKNEK-TALVV-EHDV-LMIDYVSDRLIV
2nq2D           GQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSNMTVVFTTHQPNQVVAIANKTLLL
1xmiD           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
2pzgB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
2pzfA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
2bbsA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
1xmiE           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
1xmiC           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
1xmiA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
2ix3A           GWKMKLALARAVLRNADILLLDEPTNHLDTV---NVAWLVNYLNTCGITSITISHDSVFLD---------
2iwhB           GWKMKLALARAVLRNADILLLDEPTNHLDTV---NVAWLVNYLNTCGITSITISHDSVFLD---------
2pzgA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
2pzeB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
2pzeA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
2bbtA           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
2bboA           GQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
2pzfB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
1yqtA           GELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEKTALVVEHDV-LID-YVSDRLV-
3b60A           XXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIA-HRLSTIEQ--------
1z2rA           XXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIA-HRLSTIEQ--------
2bbtB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
2bbsB           GQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLMANKTRILVTSKMEHLKKAD-KILIL
2pjzA           GQSVLVRTSLALASQPEIVGLDEPFENVDAARRHVISRYIKEYGKEG---ILVTHELDMLNLYK------
2d2eA           GEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYIQPDKVVM
2cbzA           GQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGMLKNKTRILV-THSMSYLPQVD------
1xf9D           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1xf9C           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1xf9B           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1xf9A           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1xfaA           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
2r6fB           GEAQRVKLAAELHRRSNLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVI----------
2r6fA           GEAQRVKLAAELHRRSNLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVI----------
1r10A           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1r0zD           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1r0zC           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1r0zB           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1r0zA           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1r0xD           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1r0xC           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1r0xB           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1r0xA           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1r0wC           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1r0wB           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1r0wA           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1q3hD           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1q3hC           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1q3hB           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
1q3hA           GQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVKLMANKTRILVTSKMEHL--RKADKILIL
2d2fA           GEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYIQPDKVVM
2ix8A           GWK-KLALARAVLRNADILLLDEPTNHLDTV---NVAWLVNYLNTCGITSITISHDSVFLD---------
2iw3B           GWK-KLALARAVLRNADILLLDEPTNHLDTV---NVAWLVNYLNTCGITSITISHDSVFLD---------
2iw3A           GWK-KLALARAVLRNADILLLDEPTNHLDTV---NVAWLVNYLNTCGITSITISHDSVFLD---------
2zu0C           GEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVVL
2d3wA           GEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVVL
1ii8B           GERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKD---------
1f2uD           GERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKD---------
1f2uB           GERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKD---------
1f2tB           GERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKD---------
1sgwA           GTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSRE--------------
1us8B           GERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKD---------
2d3wD           GEKKRNDILQMAVLEPELCILDESDG-LDIDALKVVADGVNSLRDGKRSFIIVTHYQRILDYIKPDYVVL
2vf8B           GELQRLRLATQLYSNGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVEHDLDVI----------
2vf8A           GELQRLRLATQLYSNGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVEHDLDVI----------
2vf7C           GELQRLRLATQLYSNGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVEHDLDVI----------
2vf7B           GELQRLRLATQLYSNGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVEHDLDVI----------
2vf7A           GELQRLRLATQLYSNGVVYVLDEPSAGLHPADTEALLSALENLKRGGNSLFVVEHDLDVI----------


                         .         .         .         +         .         .         .:280
query           HQGRLHIYx
3dhwC           SNGEL----
2pcjA           ---------
1l2tB           ---------
1l2tA           ---------
1b0uA           HQGKI----
1f3oA           ---------
2yyzA           NQGKLVQY-
2it1B           ---------
2it1A           ---------
1g291           ---------
2oukB           DGG------
2oljA           DGG------
2d62A           NKGEL----
1oxvA           ---------
1oxsC           ---------
3d31A           ---------
2onkA           ---------
1q12A           ---------
3fh6A           ---------
2awoA           ---------
2awnB           ---------
2r6gB           ---------
2r6gA           ---------
1z47B           HEGNV----
1z47A           HEGNV----
3fvqB           KQGRI----
3fvqA           KQGRI----
3gfoA           ---------
1mt0A           EKGKI----
2ff7A           EKGKI----
2fgkA           EKGKI----
2ffbA           EKGKI----
3b5jA           EKGKI----
1xefA           ---------
2ffaA           ---------
2awoC           ---------
2awnC           ---------
1v43A           NRGQL----
1mv5D           ---------
1mv5A           ---------
3g60A           ---------
3g5uA           ---------
2ghiA           NKGKI----
2ihyA           ---------
1oxxK           ---------
1vplA           HNGTI----
1ji0A           ---------
2ixfC           ---------
2ixfA           ---------
2yz2B           EKGK-----
2yz2A           EKGK-----
2ixfD           ---------
2hydA           ---------
2ghiC           NKGKI----
2ihyB           ---------
2ghiB           NKGKI----
2ixeA           ---------
2ghiD           NKGKI----
1pf4A           DEGEI----
2ixeD           ---------
1g6hA           FNGQI----
1jj7A           ---------
1g9xA           FNGQI----
1gajA           FNGQI----
1xmiB           HEGSSYFY-
2ixgA           ---------
2nq2C           NK-------
3bk7A           FEG------
2nq2D           NK-------
1xmiD           HEGSSYFY-
2pzgB           HEGSSYFY-
2pzfA           HEGSSYFY-
2bbsA           HEGSSYFY-
1xmiE           HEGSSYFY-
1xmiC           HEGSSYFY-
1xmiA           HEGSSYFY-
2ix3A           ---------
2iwhB           ---------
2pzgA           HEGSSYFY-
2pzeB           HEGSSYFY-
2pzeA           HEGSSYFY-
2bbtA           HEGSSYFY-
2bboA           HEGSSYFY-
2pzfB           HEGSSYFY-
1yqtA           ---------
3b60A           ---------
1z2rA           ---------
2bbtB           HEGSSYFY-
2bbsB           HEGSSYFY-
2pjzA           ---------
2d2eA           MDGRV----
2cbzA           ---------
1xf9D           HQGSSYFY-
1xf9C           HQGSSYFY-
1xf9B           HQGSSYFY-
1xf9A           HQGSSYFY-
1xfaA           HQGSSYFY-
2r6fB           ---------
2r6fA           ---------
1r10A           HQGSSYFY-
1r0zD           HQGSSYFY-
1r0zC           HQGSSYFY-
1r0zB           HQGSSYFY-
1r0zA           HQGSSYFY-
1r0xD           HQGSSYFY-
1r0xC           HQGSSYFY-
1r0xB           HQGSSYFY-
1r0xA           HQGSSYFY-
1r0wC           HQGSSYFY-
1r0wB           HQGSSYFY-
1r0wA           HQGSSYFY-
1q3hD           HQGSSYFY-
1q3hC           HQGSSYFY-
1q3hB           HQGSSYFY-
1q3hA           HQGSSYFY-
2d2fA           MDGRV----
2ix8A           ---------
2iw3B           ---------
2iw3A           ---------
2zu0C           YQGRI----
2d3wA           YQGRI----
1ii8B           ---------
1f2uD           ---------
1f2uB           ---------
1f2tB           ---------
1sgwA           ---------
1us8B           ---------
2d3wD           YQGRI----
2vf8B           ---------
2vf8A           ---------
2vf7C           ---------
2vf7B           ---------
2vf7A           ---------