[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for rpal2:ABE38253.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3fmwA.bssp"
#ERROR : Can't open dsspfile "3fmwC.bssp"
#ERROR : Can't open dsspfile "2qa1A.bssp"
#ERROR : Can't open dsspfile "3fmwB.bssp"
#ERROR : Can't open dsspfile "2qa2A.bssp"
#ERROR : Can't open dsspfile "1pn0C.bssp"
#ERROR : Can't open dsspfile "1fohD.bssp"
#ERROR : Can't open dsspfile "1fohC.bssp"
#ERROR : Can't open dsspfile "1pn0A.bssp"
#ERROR : Can't open dsspfile "2dkiA.bssp"
#ERROR : Can't open dsspfile "1fohB.bssp"
#ERROR : Can't open dsspfile "1fohA.bssp"
#ERROR : Can't open dsspfile "2dkhA.bssp"
#ERROR : Can't open dsspfile "3ihgA.bssp"
#ERROR : Can't open dsspfile "2r0gB.bssp"
#ERROR : Can't open dsspfile "2r0gA.bssp"
#ERROR : Can't open dsspfile "2r0cA.bssp"
#ERROR : Can't open dsspfile "2r0pA.bssp"
#ERROR : Can't open dsspfile "3eptB.bssp"
#ERROR : Can't open dsspfile "3eptA.bssp"
#ERROR : Can't open dsspfile "1cc4A.bssp"
#ERROR : Can't open dsspfile "1bgjA.bssp"
#ERROR : Can't open dsspfile "1ykjB.bssp"
#ERROR : Can't open dsspfile "1ykjA.bssp"
#ERROR : Can't open dsspfile "1pxcA.bssp"
#ERROR : Can't open dsspfile "1pbfA.bssp"
#ERROR : Can't open dsspfile "1dobA.bssp"
#ERROR : Can't open dsspfile "1d7lA.bssp"
#ERROR : Can't open dsspfile "1pxbA.bssp"
#ERROR : Can't open dsspfile "1phhA.bssp"
#ERROR : Can't open dsspfile "1pbeA.bssp"
#ERROR : Can't open dsspfile "1pbbA.bssp"
#ERROR : Can't open dsspfile "1cj4A.bssp"
#ERROR : Can't open dsspfile "1cj3A.bssp"
#ERROR : Can't open dsspfile "1cj2A.bssp"
#ERROR : Can't open dsspfile "1bkwA.bssp"
#ERROR : Can't open dsspfile "1bgnA.bssp"
#ERROR : Can't open dsspfile "1bf3A.bssp"
#ERROR : Can't open dsspfile "1k0iA.bssp"
#ERROR : Can't open dsspfile "1cc6A.bssp"

## Summary of PDB Search
:540
    2e-21  32%  3fmwA  [x.x.x] OXYGENASE
    1e-20  32%  3fmwC  [x.x.x] OXYGENASE
    5e-20  29%  2qa1A  [x.x.x] POLYKETIDE OXYGENASE PGAE
    5e-20  31%  3fmwB  [x.x.x] OXYGENASE
    3e-19  31%  2qa2A  [x.x.x] POLYKETIDE OXYGENASE CABE
    4e-17  33%  1pn0C  [c.3.1 - d.16.1 - c.47.1] PHENOL 2-MONOOXYGENASE
    2e-16  33%  1fohD  [c.3.1 - d.16.1 - c.47.1] PHENOL HYDROXYLASE
    2e-16  33%  1fohC  [c.3.1 - d.16.1 - c.47.1] PHENOL HYDROXYLASE
    2e-16  33%  1pn0A  [c.3.1 - d.16.1 - c.47.1] PHENOL 2-MONOOXYGENASE
    4e-16  28%  2dkiA  [x.x.x] 3-HYDROXYBENZOATE HYDROXYLASE
    1e-15  33%  1fohB  [c.3.1 - d.16.1 - c.47.1] PHENOL HYDROXYLASE
    1e-15  33%  1fohA  [c.3.1 - d.16.1 - c.47.1] PHENOL HYDROXYLASE
    4e-15  28%  2dkhA  [x.x.x] 3-HYDROXYBENZOATE HYDROXYLASE
    8e-15  30%  3ihgA  [x.x.x] RDME
    1e-14  31%  2r0gB  [x.x.x] REBC
    1e-14  31%  2r0gA  [x.x.x] REBC
    4e-14  30%  2r0cA  [x.x.x] REBC
    7e-14  30%  2r0pA  [x.x.x] REBC
    2e-13  29%  3eptB  [x.x.x] REBC
    2e-13  29%  3eptA  [x.x.x] REBC
    3e-06  27%  1cc4A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    4e-06  27%  1bgjA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    1e-05  27%  1ykjB  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    1e-05  27%  1ykjA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    1e-05  27%  1pxcA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    1e-05  27%  1pbfA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    1e-05  27%  1dobA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    1e-05  27%  1d7lA  [c.3.1 - d.16.1] P-HYDROXYBENZOATE HYDROXYLASE
    2e-05  28%  1pxbA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    2e-05  27%  1phhA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    2e-05  27%  1pbeA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    2e-05  27%  1pbbA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    2e-05  27%  1cj4A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    2e-05  27%  1cj3A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    2e-05  27%  1cj2A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    2e-05  27%  1bkwA  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
    2e-05  27%  1bgnA  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    2e-05  27%  1bf3A  [x.x.x] P-HYDROXYBENZOATE HYDROXYLASE
    4e-05  26%  1k0iA  [c.3.1 - d.16.1] P-HYDROXYBENZOATE HYDROXYLASE
    8e-05  26%  1cc6A  [c.3.1 - d.16.1] PROTEIN (P-HYDROXYBENZOATE HYDROXYLASE)
:540

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSLAIDLAQRGENVVLLDDADRIGEGSRAICF
3fmwA           ----------------------------------------------------------------------
3fmwC           ----------------------------------------------------------------------
2qa1A           ----------------------------------------------------------------SRGLGF
3fmwB           ----------------------------------------------------------------------
2qa2A           --------------------------------------LMLAGELRLGGVDVMVLEQLPQRTGESRGLGF
1pn0C           ----------------------------------------------------------------------
1fohD           ----------------------------------------------------------------------
1fohC           ----------------------------------------------------------------------
1pn0A           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
1fohB           ----------------------------------------------------------------------
1fohA           ----------------------------------------------------------------------
2dkhA           ----------------------------------------------------------------------
3ihgA           ----------------------------------------------------------------------
2r0gB           --------------------------------------MALALDLAHRQVGHLVVEQTDGTITHPRVGTI
2r0gA           --------------------------------------MALALDLAHRQVGHLVVEQTDGTITHPRVGTI
2r0cA           --------------------------------------MALALDLAHRQVGHLVVEQTDGTITHPRVGTI
2r0pA           --------------------------------------MALALDLAHRQVGHLVVEQTDGTITHPRVGTI
3eptB           --------------------------------------MALALDLAHRQVGHLVVEQTDGTITHPRVGTI
3eptA           --------------------------------------MALALDLAHRQVGHLVVEQTDGTITHPRVGTI
1cc4A           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
1ykjB           ----------------------------------------------------------------------
1ykjA           ----------------------------------------------------------------------
1pxcA           ----------------------------------------------------------------------
1pbfA           ----------------------------------------------------------------------
1dobA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
1pxbA           ----------------------------------------------------------------------
1phhA           ----------------------------------------------------------------------
1pbeA           ----------------------------------------------------------------------
1pbbA           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
1cj3A           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
1bkwA           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
1bf3A           ----------------------------------------------------------------------
1k0iA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SKRALEVWDRLGVGARMVEKGVVWQVGKIFRRDEMVYQFDLLPETGHKMPAFINLQQYYAEAYLVERVQQ
3fmwA           -----------------------------------------LVDTRHPYTGLV--PQSRTEALLAEHARE
3fmwC           -----------------------------------------LVDTRHPYTGLV--PQSRTEALLAEHARE
2qa1A           TARTMEVFDQRGILPRFVETSTQGHFGGL------PIDFGVLEGAWQ---AAKTVPQSVTETHLEQWATG
3fmwB           -----------------------------------------LVDTRHPYTGLV--PQSRTEALLAEHARE
2qa2A           TARTMEVFDQRGIGGRPVDFGVL---------EGAHYGVKAVPQS---------TTESVLEEWALGRGAE
1pn0C           ----------------------------------------------------------------------
1fohD           ----------------------------------------------------------------------
1fohC           ----------------------------------------------------------------------
1pn0A           ----------------------------------------------------------------------
2dkiA           ------------------------QPGRIARHGRVQDTEDGLSEFPH-----VILNQARVHDHYLERMRN
1fohB           ----------------------------------------------------------------------
1fohA           ----------------------------------------------------------------------
2dkhA           ------------------------QPGRIARHGRVQDTEDGLSEFPH-----VILNQARVHDHYLERMRN
3ihgA           ----------------------------------------------------------------------
2r0gB           GPRSMELFRRWGVGDHPLDAAWVTRVGEVYRIPLGTADTRATPEHTPEPDAIC--PQHWLAPLLAEAVGE
2r0gA           GPRSMELFRRWGVGDHPLDAAWVTRVGEVYRIPLGTADTRATPEHTPEPDAIC--PQHWLAPLLAEAVGE
2r0cA           GPRSMELFRRWGVGDHPLDAAWVTRVGEVYRIPLGTADTRATPEHTPEPDAIC--PQHWLAPLLAEAVGE
2r0pA           GPRSMELFRRWGVGDHPLDAAWVTRVGEVYRIPLGTADTRATPEHTPEPDAIC--PQHWLAPLLAEAVGE
3eptB           GPRSMELFRRWGVGDHPLDAAWVTRVGEVYRIPLGTADTRATPEHTPEPDAIC--PQHWLAPLLAEAVGE
3eptA           GPRSMELFRRWGVGDHPLDAAWVTRVGEVYRIPLGTADTRATPEHTPEPDAIC--PQHWLAPLLAEAVGE
1cc4A           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
1ykjB           ----------------------------------------------------------------------
1ykjA           ----------------------------------------------------------------------
1pxcA           ----------------------------------------------------------------------
1pbfA           ----------------------------------------------------------------------
1dobA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
1pxbA           ----------------------------------------------------------------------
1phhA           ----------------------------------------------------------------------
1pbeA           ----------------------------------------------------------------------
1pbbA           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
1cj3A           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
1bkwA           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
1bf3A           ----------------------------------------------------------------------
1k0iA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LPQIDLRWRNKVTALAQHNDHAVLTIETPDGSYRLAADYVVACDGARSALRGMVGAEFAGEVFEDQFLIA
3fmwA           AGA-EIPRGHEVTRLRQDAEAVEVTVAGPSGPYPVRARYGVGCDGGRSTVRRLAADRFPGTEATVRALIG
3fmwC           AGA-EIPRGHEVTRLRQDAEAVEVTVAGPSGPYPVRARYGVGCDGGRSTVRRLAADRFPGTEATVRALIG
2qa1A           LGA-DIRRGHEVLSLTDDGAGVTVEVRGPEGKHTLRAAYLVGCDGGRSSVRKAAGFDFPGTAATMEMYLA
3fmwB           AGA-EIPRGHEVTRLRQDAEAVEVTVAGPSGPYPVRARYGVGCDGGRSTVRRLAADRFPGTEATVRALIG
2qa2A           LLR-----GHTVRALTXXXXXXXXXXXXXXXXRSLTTRYVVGCDGGRSTVRKAAGFDFPGTSASREMFLA
1pn0C           ------------------------TQEEEDANYRLPCKYVIGCDGGHSWVRRTLGFEMIGEQTDYIWGVL
1fohD           ------------------------TQEEEDANYRLPCKYVIGCDGGHSWVRRTLGFEMIGEQTDYIWGVL
1fohC           ------------------------TQEEEDANYRLPCKYVIGCDGGHSWVRRTLGFEMIGEQTDYIWGVL
1pn0A           ------------------------TQEEEDANYRLPCKYVIGCDGGHSWVRRTLGFEMIGEQTDYIWGVL
2dkiA           SPRLEPHYARRVLDVKVDHGAATVTLERCDAAHAVQARYVVGCDGARSNVRRAIGRQLVGDSANQAWGVM
1fohB           ------------------------TQEEEDANYRLPCKYVIGCDGGHSWVRRTLGFEMIGEQTDYIWGVL
1fohA           ------------------------TQEEEDANYRLPCKYVIGCDGGHSWVRRTLGFEMIGEQTDYIWGVL
2dkhA           SPRLEPHYARRVLDVKVDHGAATVTLERCDAAHAVQARYVVGCDGARSNVRRAIGRQLVGDSANQAWGVM
3ihgA           -----IRFGTRLLSFRQHDDDATARLAGPDGEYDLRAGYLVGADGNRSLVRESLGTHMVGVIFD-----A
2r0gB           R----LRTRSRLDSFEQRDDHVRATIDLRTGATRAVARYLVACDGASSPTRKALGIDHRTQVFRNLFRAP
2r0gA           R----LRTRSRLDSFEQRDDHVRATIDLRTGATRAVARYLVACDGASSPTRKALGIDHRTQVFRNLFRAP
2r0cA           R----LRTRSRLDSFEQRDDHVRATIDLRTGATRAVARYLVACDGASSPTRKALGIDHRTQVFRNLFRAP
2r0pA           R----LRTRSRLDSFEQRDDHVRATIDLRTGATRAVARYLVACDGASSPTRKALGIDHRTQVFRNILFRA
3eptB           R----LRTRSRLDSFEQRDDHVRATIDLRTGATRAVARYLVACDGASSPTRKALGIDHRTQVFRNILFRA
3eptA           R----LRTRSRLDSFEQRDDHVRATIDLRTGATRAVARYLVACDGASSPTRKALGIDHRTQVFRNILFRA
1cc4A           -----------------------VTFERDGERLRLDCDYIAGCDGAHGISRQSIPAERL-KVFERVYPFG
1bgjA           -----------------------VTFERDGERLRLDCDYIAGCDGFRGISRQSIPAERL-KVFERVYPFG
1ykjB           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1ykjA           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1pxcA           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1pbfA           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1dobA           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1d7lA           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1pxbA           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1phhA           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1pbeA           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1pbbA           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1cj4A           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1cj3A           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1cj2A           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1bkwA           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1bgnA           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1bf3A           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1k0iA           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISRQSIPAERL-KVFERVYPFG
1cc6A           -----------------------VTFERDGERLRLDCDYIAGCDGFHGISSQSIPAERL-KVFERVYPFG


                         .         .         .         +         .         .         .:280
query           DVRMNAEFPTERWFWFDPPFHSGQSALLHRQPDNVWRIDLQIGADADAAVERLPENVRPRIERMLGNSDF
3fmwA           YVTTPEREVPRRW---------------ERTPDGILVLAFPPGWSSSSTGHSGPEDLGAAVARVRGTPLT
3fmwC           YVTTPEREVPRRWLAFPPGWSSSSTGHSDEGPVTL--------EDLGAAVARVRGTPLTLTEPV------
2qa1A           DIK-GVELQ---------PRMIGETXXXXXXXXXXXXXXITRIIVCERGTPPPPSEVADAWKRLTGDDIA
3fmwB           YVT-TPEVPRR---WERTP---DGILVLAFPPEGGWSSSSTGHSDEGPVTL---EDLGAAVARVRG----
2qa2A           DIR-GCEI-TPRPIGETVPLGMVMSAPLGDGVDRIIVCEXXXXXXXXXXXXXYQE-VAAAWQRLTGQDIS
1pn0C           DAVPASNFPDIRSRCAIHSAESGSIMIIPRE-NNLVRFYVQLQARVDRT-KFTPEVVIANAKKIFHPYTF
1fohD           DAVPASNFPDIRSRCAIHSAESGSIMIIPRE-NNLVRFYVQLQVDR---TKFTPEVVIANAKKIFHPYTF
1fohC           DAVPASNFPDIRSRCAIHSAESGSIMIIPRE-NNLVRFYVQLRVDR---TKFTPEVVIANAKKIFHPYTF
1pn0A           DAVPASNFPDIRSRCAIHSAESGSIMIIPRE-NNLVRFYVQL-----QATKFTPEVVIANAKKIFHPYTF
2dkiA           DVLAVTDFPDVR---YKVAIQSEQGNVLIIPREGGHLVRFYVEMDRNITVEQLIATAQ-RVLHPYKLEVK
1fohB           DAVPASNFPDIRSRCAIHSAESGSIMIIPRE-NNLVRFYVQL--------QFTPEVVIANAKKIFHPYTF
1fohA           DAVPASNFPDIRSRCAIHSAESGSIMIIPRE-NNLVRFYVQL--------QFTPEVVIANAKKIFHPYTF
2dkhA           DVLAVTDFPDVR-YKVAIQSEQGNVLIIPREGGHLVRFYVEMD---NITVEQLIATAQ-RVLHPYKLEVK
3ihgA           DLSGIMEPGTTGWYYLHHPEFKGTFGPTDR-PD---RHTLFVEYDPDEG-ER-PEDFTPQIGLALDAPEV
2r0gB           ELR---SLLGERAAXXXXXXXXXXXXXPLRALDGRGLYRLTVGVDTMDSFELVRRAVAFDTEEVLSDS--
2r0gA           ELR---SLLGERAAXXXXXXXXXXXXXPLRALDGRGLYRLTVGVDTMDSFELVRRAVAFDTEEVLSDS--
2r0cA           ELR---SLLGERAAXXXXXXXXXXXXXPLRALDGRGLYRLTVGVD-DASKSTMDSF---ELVRRAVAFDT
2r0pA           P-----ELRSLLGEXXXXXXXXXXXXXXXXXXDGRGLYRLTVGVDTMDSFELVRRAVAFDTEEVLSDS--
3eptB           PELRSLLGERAAXXXXXXXXXXXXXPLRALDGRGLYRLTVGVDDTMDSF-----ELVRRAVA-----FDT
3eptA           PELRSLLGERAAXXXXXXXXXXXXXPLRALDGRGLYRLTVGVDDTMDSF-----ELVRRAVA-----FDT
1cc4A           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEDWSDERFWTELKARLEKLVTGPSL
1bgjA           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEDWSDERFWTELKARLEKLVTGPSL
1ykjB           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLSEDWSDERFWTELKARLEKLVTGPSL
1ykjA           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLSEDWSDERFWTELKARLEKLVTGPSL
1pxcA           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLSEDWSDERFWTELKARLEKLVTGPSL
1pbfA           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYAVQVPLTEDWSDERFWTELKARLEKLVTGPSL
1dobA           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYFVQVPLSEDWSDERFWTELKARLEKLVTGPSL
1d7lA           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLSEDWSDERFWTELKARLEKLVTGPSL
1pxbA           WLGLLADTPPELIF----ANHPRGFALCSQRSATRSRYYVQVPLSEDWSDERFWTELKARLEKLVTGPSL
1phhA           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEDWSDERFWTELKARLEKLVTGPSL
1pbeA           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEDWSDERFWTELKARLEKLVTGPSL
1pbbA           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEDWSDERFWTELKARLEKLVTGPSL
1cj4A           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEDWSDERFWTELKARLEKLVTGPSL
1cj3A           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEDWSDERFWTELKARLEKLVTGPSL
1cj2A           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEDWSDERFWTELKARLEKLVTGPSL
1bkwA           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEDWSDERFWTELKARLEKLVTGPSL
1bgnA           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEDWSDERFWTELKARLEKLVTGPSL
1bf3A           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEDWSDERFWTELKARLEKLVTGPSL
1k0iA           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSQYYVQVPLSEDWSDERFWTELKARLEKLVTGPSL
1cc6A           WLGLLADTPSHELIYAN---HPRGFALCSQRSATRSRYYVQVPLTEDWSDERFWTELKARLEKLVTGPSL


                         .         *         .         .         .         .         +:350
query           SFEWISIYKFQCRRMQRFLHERVIFAGDSAHQVSPFGARGANSGLEDGENIAWKLAMVLRGDAPASLLDS
3fmwA           LTEWLSRFGDASRQAKRYRSGRVLLAGDAAHVHFPIGGQGLNTGLQDAVNLGWKLAARVRGWGSEELLDT
3fmwC           --SWLSRFGDASRQAKRYRSGRVLLAGDAAHVHFPIGGQGLNTGLQDAVNLGWKLAARVRGWGSEELLDT
2qa1A           HAEWVSAFGNATRQVTEYRRGRVILAGDSAHIHLPAGGQGMNTSIQDAVNLGWKLGAVVNGTATEELLDS
3fmwB           PVSWLSRFGDASRQAKRYRSGRVLLAGDAAHVHFPIGGQGLNTGLQDAVNLGWKLAARVRGWGSEELLDT
2qa2A           HGEWVSAFGDPARQVSAYRRGRVLLAGDSAHVHLPAGGQGMNVSVQDSVNLGWKLAAVVSGRAPAGLLDT
1pn0C           DLDWFTAYHIGQRVTEKFSKERVFIAGDACHTHSPKAGQGMNTSMMDTYNLGWKLGLVLTGRAKRDILKT
1fohD           DLDWFTAYHIGQRVTEKFSKERVFIAGDACHTHSPKAGQGMNTSMMDTYNLGWKLGLVLTGRAKRDILKT
1fohC           DLDWFTAYHIGQRVTEKFSKERVFIAGDACHTHSPKAGQGMNTSMMDTYNLGWKLGLVLTGRAKRDILKT
1pn0A           DLDWFTAYHIGQRVTEKFSKERVFIAGDACHTHSPKAGQGMNTSMMDTYNLGWKLGLVLTGRAKRDILKT
2dkiA           NVPWWSVYEIGQRICAKYDDPRVFIAGDACHTHSPKAGQGMNFSMQDSFNLGWKLAAVLRKQCAPELLHT
1fohB           DLDWFTAYHIGQRVTEKFSKERVFIAGDACHTHSPKAGQGMNTSMMDTYNLGWKLGLVLTGRAKRDILKT
1fohA           DLDWFTAYHIGQRVTEKFSKERVFIAGDACHTHSPKAGQGMNTSMMDTYNLGWKLGLVLTGRAKRDILKT
2dkhA           NVPWWSVYEIGQRICAKYDDPRVFIAGDACHTHSPKAGQGMNFSMQDSFNLGWKLAAVLRKQCAPELLHT
3ihgA           KPELVDIWEMAARIAERWREGRVFLAGDAAKVTPPTGGMSGNAAVADGFDLAWKXXXXXXXXXXXXXXDT
2r0gB           --EWHLTH----RVADSFSAGRVFLTGDAAHTLSPSGGFGMNTGIGSAADLGWKLAATLRGWAGPGLLAT
2r0gA           --EWHLTH----RVADSFSAGRVFLTGDAAHTLSPSGGFGMNTGIGSAADLGWKLAATLRGWAGPGLLAT
2r0cA           EIEVLSDSEWHLRVADSFSAGRVFLTGDAAHTLSPSGGFGMNTGIGSAADLGWKLAATLRGWAGPGLLAT
2r0pA           --EWHLTH----RVADSFSAGRVFLTGDAAHTLSPSGGFGMNTGIGSAADLGWKLAATLRGWAGPGLLAT
3eptB           EIEVLSDSEWHLRVADSFSAGRVFLTGDAAHTLSPSGGFGMNTGIGSAADLGWKLAATLRGWAGPGLLAT
3eptA           EIEVLSDSEWHLRVADSFSAGRVFLTGDAAHTLSPSGGFGMNTGIGSAADLGWKLAATLRGWAGPGLLAT
1cc4A           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1bgjA           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1ykjB           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1ykjA           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1pxcA           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1pbfA           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1dobA           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1d7lA           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1pxbA           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1phhA           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1pbeA           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1pbbA           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1cj4A           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1cj3A           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1cj2A           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1bkwA           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1bgnA           EKSIAPLTSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1bf3A           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1k0iA           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER
1cc6A           EKSIAPLRSFVVEPMQ---HGRLFLAGDAAHIVPPTGAKGLNLAASDVSTL-YRLLLKAYREGRGELLER


                         .         .         .         .         *         .         .:420
query           YEIERSQAADDNIRHSTRSTDFIAPHSKQEXXXXXXXXXXXXXXEFAKRMVNAGRLSTPTAYDTPLSTPD
3fmwA           YHDERHPVAE------------------------------------------------------------
3fmwC           YHDERHPVAE------------------------------------------------------------
2qa1A           YHSER-----------------------------------------------------------------
3fmwB           YHDERHPVAE------------------------------------------------------------
2qa2A           YHEER-----------------------------------------------------------------
1pn0C           YEEERQPFA-------------------------------------------------------------
1fohD           YEEER-----------------------------------------------------------------
1fohC           YEEER-----------------------------------------------------------------
1pn0A           YEEERQPFA-------------------------------------------------------------
2dkiA           YSSERQVVAQQLI---------------------------------------------------------
1fohB           YEEER-----------------------------------------------------------------
1fohA           YEEER-----------------------------------------------------------------
2dkhA           YSSERQVVAQQLI---------------------------------------------------------
3ihgA           YEDERKXXXXXXXXXXXXYAQRMAPHMAEVWDKSVGYPETLLGFRYRSSAVLATD-DDPARVENPL-TPS
2r0gB           YEEERRPVA-------------------------------------------------------------
2r0gA           YEEERRPVA-------------------------------------------------------------
2r0cA           YEEERRPVA-------------------------------------------------------------
2r0pA           YEEERRPVA-------------------------------------------------------------
3eptB           YEEERRPVA-------------------------------------------------------------
3eptA           YEEERRPVA-------------------------------------------------------------
1cc4A           Y---------------------------------------------------------------------
1bgjA           Y---------------------------------------------------------------------
1ykjB           Y---------------------------------------------------------------------
1ykjA           Y---------------------------------------------------------------------
1pxcA           Y---------------------------------------------------------------------
1pbfA           Y---------------------------------------------------------------------
1dobA           Y---------------------------------------------------------------------
1d7lA           Y---------------------------------------------------------------------
1pxbA           Y---------------------------------------------------------------------
1phhA           Y---------------------------------------------------------------------
1pbeA           Y---------------------------------------------------------------------
1pbbA           Y---------------------------------------------------------------------
1cj4A           Y---------------------------------------------------------------------
1cj3A           Y---------------------------------------------------------------------
1cj2A           Y---------------------------------------------------------------------
1bkwA           Y---------------------------------------------------------------------
1bgnA           Y---------------------------------------------------------------------
1bf3A           Y---------------------------------------------------------------------
1k0iA           Y---------------------------------------------------------------------
1cc6A           Y---------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ADAWSAGPKXXXXXXXXXXXXXXXXPVFLTDAFKAAGCGFVLLEIANGAAAPAPQGVRSLRIGKDAPLRD
3fmwA           ----------------------------------------------------------------------
3fmwC           ----------------------------------------------------------------------
2qa1A           ----------------------------------------------------------------------
3fmwB           ----------------------------------------------------------------------
2qa2A           ----------------------------------------------------------------------
1pn0C           ----------------------------------------------------------------------
1fohD           ----------------------------------------------------------------------
1fohC           ----------------------------------------------------------------------
1pn0A           ----------------------------------------------------------------------
2dkiA           ----------------------------------------------------------------------
1fohB           ----------------------------------------------------------------------
1fohA           ----------------------------------------------------------------------
2dkhA           ----------------------------------------------------------------------
3ihgA           GRPGFRGPHVLVSRHGER--------LSTVDLF---GDGWTLLAGELGAXXXLGVPVRAYRVG--AGLTD
2r0gB           ----------------------------------------------------------------------
2r0gA           ----------------------------------------------------------------------
2r0cA           ----------------------------------------------------------------------
2r0pA           ----------------------------------------------------------------------
3eptB           ----------------------------------------------------------------------
3eptA           ----------------------------------------------------------------------
1cc4A           ----------------------------------------------------------------------
1bgjA           ----------------------------------------------------------------------
1ykjB           ----------------------------------------------------------------------
1ykjA           ----------------------------------------------------------------------
1pxcA           ----------------------------------------------------------------------
1pbfA           ----------------------------------------------------------------------
1dobA           ----------------------------------------------------------------------
1d7lA           ----------------------------------------------------------------------
1pxbA           ----------------------------------------------------------------------
1phhA           ----------------------------------------------------------------------
1pbeA           ----------------------------------------------------------------------
1pbbA           ----------------------------------------------------------------------
1cj4A           ----------------------------------------------------------------------
1cj3A           ----------------------------------------------------------------------
1cj2A           ----------------------------------------------------------------------
1bkwA           ----------------------------------------------------------------------
1bgnA           ----------------------------------------------------------------------
1bf3A           ----------------------------------------------------------------------
1k0iA           ----------------------------------------------------------------------
1cc6A           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EEGLFTKRYDATPGAAYLLRPDGYVAARxxxxxxxxxxxxxxxxxxxxxx
3fmwA           --------------------------------------------------
3fmwC           --------------------------------------------------
2qa1A           --------------------------------------------------
3fmwB           --------------------------------------------------
2qa2A           --------------------------------------------------
1pn0C           --------------------------------------------------
1fohD           --------------------------------------------------
1fohC           --------------------------------------------------
1pn0A           --------------------------------------------------
2dkiA           --------------------------------------------------
1fohB           --------------------------------------------------
1fohA           --------------------------------------------------
2dkhA           --------------------------------------------------
3ihgA           PESAVSERYGIGKAGASLVRPDGIVAWR----------------------
2r0gB           --------------------------------------------------
2r0gA           --------------------------------------------------
2r0cA           --------------------------------------------------
2r0pA           --------------------------------------------------
3eptB           --------------------------------------------------
3eptA           --------------------------------------------------
1cc4A           --------------------------------------------------
1bgjA           --------------------------------------------------
1ykjB           --------------------------------------------------
1ykjA           --------------------------------------------------
1pxcA           --------------------------------------------------
1pbfA           --------------------------------------------------
1dobA           --------------------------------------------------
1d7lA           --------------------------------------------------
1pxbA           --------------------------------------------------
1phhA           --------------------------------------------------
1pbeA           --------------------------------------------------
1pbbA           --------------------------------------------------
1cj4A           --------------------------------------------------
1cj3A           --------------------------------------------------
1cj2A           --------------------------------------------------
1bkwA           --------------------------------------------------
1bgnA           --------------------------------------------------
1bf3A           --------------------------------------------------
1k0iA           --------------------------------------------------
1cc6A           --------------------------------------------------